Recombinant Saccharomyces cerevisiae Uncharacterized protein YBR255C-A (YBR255C-A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Uncharacterized Protein YBR255C-A (Rcf3)

Saccharomyces cerevisiae Uncharacterized protein YBR255C-A, also known as Rcf3, is a protein that is found in the yeast Saccharomyces cerevisiae . Rcf3 is located in the inner mitochondrial membrane and associates with respiratory supercomplexes . While initially its precise function remained unknown, research has shed light on its role in the respiratory chain .

Role in Respiratory Chain Supercomplexes

In S. cerevisiae, respiratory chain supercomplexes are formed by the association of the bc1 complex with cytochrome c oxidase, a process facilitated by respiratory supercomplex factors like Rcf1, Rcf2, and Rcf3 . Rcf1 facilitates the oligomerization and stabilization of complex III (cytochrome c reductase) dimer with complex IV (cytochrome c oxidase) . Rcf3 associates with supercomplexes through complex IV . Rcf2 and Rcf3 have overlapping roles, and a deficiency in both factors upregulates cytochrome c oxidase activity, increasing oxygen flux through the respiratory chain .

Rcf3 and Rcf2 Homology

Rcf3 exhibits homology to the N-terminal region of Rcf2 . Rcf1 is homologous to the C-terminal portion of Rcf2 . Both Rcf3 and the C-terminal fragment of Rcf2 associate with monomeric cytochrome c oxidase and respiratory chain supercomplexes .

Localization and Expression

Rcf3 is exclusively located in the mitochondria . Fluorescence microscopic analyses of living cells expressing Rcf3-GFP showed co-localization of the GFP signal with mitochondria .

Predicted Functional Partners

Several proteins have predicted functional partnerships with Rcf3, including:

  • COR1: Core subunit of the ubiquinol-cytochrome c reductase complex.

  • NAB2: Nuclear polyadenylated RNA-binding protein.

  • YBR201C-A: Putative protein of unknown function.

  • YJR085C: TMEM14 protein homolog YJR085C.

  • YBL059W: Uncharacterized protein YBL059W.

  • AIM41: Altered inheritance of mitochondria protein 41, mitochondrial.

  • YKL065W-A: Uncharacterized protein YKL065W-A.

  • COX13: Subunit VIa of cytochrome c oxidase.

  • RCF1: Respiratory supercomplex factor 1, mitochondrial.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
YBR255C-A; Uncharacterized protein YBR255C-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBR255C-A
Target Protein Sequence
MGGNVLPIHYDPKTVKQLTKEITVASCIGAAQGALFSIASALLLRRFSSVYRNVRTQVRV FYHCSWISMGAVFRADKQLLKFQTNYYREEQKRREKIMDEAAERGLFLEDESLNSSRSTT
Uniprot No.

Target Background

Gene References Into Functions
  1. This study describes the maturation of Rcf2 into N- and C-terminal peptides. It identifies Rcf3 (YBR255c-A) as a homolog of the N-terminal Rcf2 peptide and Rcf1 as homologous to the C-terminal portion. Both Rcf3 and the C-terminal fragment of Rcf2 interact with monomeric cytochrome c oxidase and respiratory chain supercomplexes. PMID: 27662906
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YBR255C-A and what is its updated nomenclature?

YBR255C-A was initially classified as an uncharacterized open reading frame in the Saccharomyces cerevisiae genome. Current research has identified this gene product as Rcf3, a respiratory supercomplex factor. Rcf3 was reported in a proteomic analysis by Helbig et al. as a yeast mitochondrial membrane protein associated with respiratory supercomplexes . The protein has been characterized as a homolog of the N-terminal Rcf2 peptide, while Rcf1 is homologous to the C-terminal portion of Rcf2 . This homology relationship has been established through detailed sequence analysis and functional studies of the respective proteins.

What is the cellular localization of YBR255C-A (Rcf3)?

Rcf3 is exclusively localized to mitochondria, specifically in the inner mitochondrial membrane. This localization has been experimentally verified using fluorescence microscopy of living cells expressing Rcf3-GFP fusion proteins, which showed clear co-localization with MitoTracker staining, confirming mitochondrial localization . Computer-based analysis of the primary sequence of Rcf3 predicts the presence of two transmembrane segments within the protein, consistent with its membrane localization . The inner mitochondrial membrane localization is significant as it positions Rcf3 optimally for interaction with respiratory chain complexes.

What are the primary structural features of YBR255C-A (Rcf3)?

Rcf3 is characterized by:

  • Two predicted transmembrane segments that anchor the protein in the inner mitochondrial membrane

  • Structural homology to the N-terminal portion of Rcf2

  • Sequence features that facilitate association with respiratory chain components, particularly complex IV (cytochrome c oxidase)

Computer-based analysis of the primary sequence has been instrumental in predicting these structural elements. The protein's membrane topology places it in proximity to the respiratory chain supercomplexes, enabling its regulatory functions in oxidative phosphorylation.

How does YBR255C-A (Rcf3) interact with respiratory chain supercomplexes?

Rcf3 predominantly interacts with respiratory chain supercomplexes via complex IV (cytochrome c oxidase). Experimental evidence from blue native PAGE (BN-PAGE) separation of supercomplexes followed by Western blotting analysis demonstrates that Rcf3 associates with both monomeric cytochrome c oxidase and higher-order respiratory chain supercomplexes .

The interaction pattern differs from that of the full-length Rcf2 protein. While Rcf2 can associate with complex IV in both its monomeric form and when assembled into supercomplexes with complex III₂, the N-terminal fragment (which has homology to Rcf3) shows reduced stability in these associations . This suggests that despite sequence similarity, Rcf3 has evolved distinct binding characteristics that affect its interaction with respiratory complexes.

Table 1: Comparison of Rcf protein association with respiratory complexes

ProteinAssociates with monomeric Complex IVAssociates with III₂-IV supercomplexesStability of association
Rcf1YesYesHigh
Rcf2 (full)YesYesHigh
Rcf2 (C-terminal)YesYesHigh
Rcf2 (N-terminal)Less stableLess stableLow
Rcf3YesYesModerate

What is the relationship between YBR255C-A (Rcf3) and other Rcf proteins?

Rcf3 shares functional and structural relationships with other respiratory supercomplex factors:

  • Rcf3 is homologous to the N-terminal peptide of Rcf2, while Rcf1 is homologous to the C-terminal portion of Rcf2 .

  • Rcf3 and Rcf2 have overlapping roles in regulating oxidative phosphorylation (OXPHOS) activity. While single gene deletions of either RCF2 or RCF3 show increased oxygen flux via complex IV without growth defects on non-fermentable medium, the double deletion mutant (rcf2Δ/rcf3Δ) demonstrates more severe phenotypes, suggesting functional redundancy between these proteins .

  • All three Rcf proteins (Rcf1, Rcf2, and Rcf3) can associate with the bc₁ complex (complex III) even in the absence of functional cytochrome c oxidase, indicating a supercomplex-independent interaction network among these proteins .

The evolutionary relationship between these proteins suggests gene duplication events followed by functional specialization, while maintaining partially overlapping roles in respiratory chain regulation.

How does deletion of YBR255C-A (Rcf3) affect cellular respiration?

Deletion of YBR255C-A (Rcf3) results in increased oxygen flux through the respiratory chain due to up-regulation of cytochrome c oxidase activity . This phenotype reveals Rcf3's role as a negative regulator of complex IV activity. Interestingly:

  • Single gene deletion of RCF3 increases oxygen consumption but does not impair growth on non-fermentable carbon sources, indicating that cells can adapt to the dysregulation of respiration .

  • The double deletion mutant rcf2Δ/rcf3Δ shows more pronounced phenotypic effects compared to single deletions, suggesting an overlapping regulatory function between Rcf2 and Rcf3 .

  • The increased respiratory activity in rcf3Δ mutants indicates that Rcf3's normal function includes modulating electron transfer efficiency within the respiratory chain, potentially preventing excessive electron flow that could lead to reactive oxygen species production.

These findings suggest that Rcf3 plays a role in fine-tuning respiratory chain activity to match cellular energy demands while minimizing oxidative stress.

What are optimal methods for expressing recombinant YBR255C-A (Rcf3)?

For successful expression and study of recombinant Rcf3, researchers should consider the following methodological approaches:

  • Expression systems:

    • Homologous expression in S. cerevisiae using low to moderate-copy plasmids with native or inducible promoters (e.g., GAL1 promoter)

    • Chromosomal integration of tagged constructs at the native locus to preserve physiological expression levels

  • Tagging strategies:

    • N-terminal tagging: Use small epitope tags like FLAG or HA to minimize interference with membrane insertion

    • C-terminal tagging: GFP fusion has been successfully employed for localization studies

    • Avoid tags that might disrupt transmembrane domains or protein-protein interaction surfaces

  • Purification considerations:

    • Two-step affinity purification using tags like TAP (Tandem Affinity Purification)

    • Gentle detergent solubilization (e.g., digitonin, DDM) to preserve native protein conformation and interactions

    • Consider purifying Rcf3 in complex with its interaction partners to maintain stability

When expressing FLAG-tagged Rcf2, researchers observed that the tagged protein localized properly to mitochondria and underwent normal proteolytic processing, demonstrating the viability of this approach for Rcf family proteins .

How can interactions between YBR255C-A (Rcf3) and respiratory complexes be studied?

Several complementary approaches can be employed to study Rcf3 interactions with respiratory complexes:

  • Blue Native PAGE (BN-PAGE):

    • Solubilize mitochondrial membranes with mild detergents (digitonin is preferred)

    • Separate intact complexes and supercomplexes on gradient gels

    • Perform second-dimension SDS-PAGE to resolve individual components

    • Detect Rcf3 and respiratory complex components via western blotting

  • Co-immunoprecipitation (Co-IP):

    • Use tagged versions of Rcf3 or complex IV components

    • Perform reciprocal Co-IPs to confirm interactions

    • Analyze pull-down fractions for presence of respiratory complex components

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest crosslinked proteins and analyze by LC-MS/MS

    • Identify specific residues involved in protein-protein interactions

  • Proximity labeling methods:

    • Fuse Rcf3 with enzymes like BioID or APEX2

    • Allow in vivo labeling of proximal proteins

    • Purify and identify labeled proteins by mass spectrometry

The BN-PAGE approach has been successfully used to demonstrate that Rcf3 associates with complex IV-containing supercomplexes and monomeric complex IV , making it a reliable starting methodology.

What techniques are most effective for analyzing YBR255C-A (Rcf3) function in vivo?

To analyze Rcf3 function in vivo, researchers should consider these methodological approaches:

  • Genetic manipulation:

    • Single and double gene deletions (rcf3Δ, rcf2Δ/rcf3Δ)

    • Site-directed mutagenesis of key residues

    • Complementation assays with mutant variants

  • Respiratory phenotype analysis:

    • Growth assays on fermentable vs. non-fermentable carbon sources

    • Oxygen consumption measurements using oxygen electrodes or plate-based respirometry

    • Measurement of membrane potential using fluorescent dyes

  • Biochemical analyses:

    • Activity assays for individual respiratory complexes

    • ROS production measurement

    • ATP synthesis rate determination

  • Structural biology approaches:

    • Cryo-EM of purified supercomplexes with and without Rcf3

    • Structural modeling based on homology with Rcf2

  • In vivo imaging:

    • Fluorescently tagged Rcf3 to monitor localization under different conditions

    • FRET analysis to detect protein-protein interactions in living cells

Studies have already demonstrated that lack of Rcf2 and Rcf3 increases oxygen flux through the respiratory chain by up-regulation of the cytochrome c oxidase activity, providing a clear phenotype that can be measured and manipulated experimentally .

How should phenotypic data from YBR255C-A (Rcf3) deletion strains be interpreted?

When interpreting phenotypic data from Rcf3 deletion strains, researchers should consider several factors:

  • Functional redundancy:

    • Single deletions may show subtle phenotypes due to compensation by Rcf2

    • Always compare single (rcf3Δ) to double (rcf2Δ/rcf3Δ) deletion strains

    • Consider triple deletions including rcf1Δ to fully understand the Rcf protein network

  • Growth conditions:

    • Fermentable vs. non-fermentable carbon sources reveal different aspects of Rcf3 function

    • Stress conditions (oxidative, temperature) may unmask phenotypes not evident under standard conditions

    • Compare growth rates and maximal cell density, not just endpoint measurements

  • Respiratory measurements:

    • Increased oxygen consumption in rcf3Δ strains indicates a regulatory role in respiration

    • Measure individual complex activities to distinguish direct from indirect effects

    • Consider that altered respiratory rates may reflect compensatory responses rather than direct effects

  • Strain background effects:

    • Different S. cerevisiae laboratory strains may show varying phenotypes

    • Always include proper isogenic controls

    • Document exact genotypes of all strains used

Research has shown that while the rcf3Δ single mutant shows increased oxygen flux through complex IV, it displays no growth defect on non-fermentable medium, unlike the more severe rcf2Δ/rcf3Δ double mutant . This highlights the importance of considering compensatory mechanisms when interpreting phenotypic data.

What statistical approaches are recommended for analyzing YBR255C-A (Rcf3) functional data?

For robust analysis of Rcf3 functional data, the following statistical approaches are recommended:

  • Experimental design considerations:

    • Minimum of three biological replicates for all experiments

    • Include technical replicates to assess measurement variation

    • Apply power analysis to determine appropriate sample sizes

  • Statistical tests for respiratory measurements:

    • One-way ANOVA with post-hoc tests (Tukey's HSD) for comparing multiple strains

    • Two-way ANOVA when examining effects of both genotype and environmental conditions

    • Consider non-parametric alternatives if normality assumptions are violated

  • Growth curve analysis:

    • Calculate doubling times from log-phase growth

    • Apply curve-fitting models (Gompertz, logistic) to extract parameters

    • Compare lag phase, maximum growth rate, and maximum cell density

  • Data normalization:

    • Normalize oxygen consumption to cell number or protein content

    • For complex activities, consider normalization to other respiratory complexes

    • Use appropriate housekeeping proteins for western blot quantification

  • Data visualization:

    • Present data as mean ± standard deviation or standard error

    • Use box plots or violin plots to show distribution of data

    • Include individual data points for small sample sizes

When comparing ribosome density data between mRNAs bound by eIF3 (which includes YBR255C-A) and those not bound, researchers have employed cumulative distribution analysis and Pearson correlation, demonstrating that such statistical approaches can reveal functional relationships .

How can contradictory findings about YBR255C-A (Rcf3) function be reconciled?

When faced with contradictory findings about Rcf3 function, researchers should systematically evaluate:

  • Methodological differences:

    • Variations in experimental techniques (BN-PAGE conditions, detergent types)

    • Different genetic backgrounds of yeast strains

    • Growth conditions and cell harvesting protocols

  • Genetic context:

    • Presence of suppressor mutations in laboratory strains

    • Effects of tagged vs. untagged proteins

    • Compensatory gene expression changes in knockout strains

  • Data interpretation frameworks:

    • Direct vs. indirect effects of Rcf3 deletion

    • Acute vs. adaptive responses to protein loss

    • Primary function vs. moonlighting activities

  • Integration approaches:

    • Develop models that incorporate seemingly contradictory findings

    • Test predictions of unified models with new experiments

    • Consider that Rcf3 may have context-dependent functions

  • Meta-analysis:

    • Systematically compare methodologies across studies

    • Weight findings based on experimental rigor

    • Identify consistent trends across diverse approaches

For example, if one study reports that Rcf3 deletion reduces respiratory function while another finds increased oxygen consumption, this could be reconciled by considering that increased but unregulated respiration might be less efficient for ATP production, ultimately impairing cellular energy metabolism despite higher oxygen consumption.

What are the most promising avenues for further YBR255C-A (Rcf3) research?

Several high-priority research directions for Rcf3 include:

  • Structural studies:

    • Determine the high-resolution structure of Rcf3 alone and in complex with respiratory components

    • Map the precise binding interface between Rcf3 and complex IV

    • Investigate potential conformational changes upon binding

  • Regulatory mechanisms:

    • Identify post-translational modifications of Rcf3 and their functional significance

    • Determine if Rcf3 expression or localization changes under different metabolic conditions

    • Investigate whether Rcf3 responds to retrograde signaling from mitochondria to nucleus

  • Interaction network expansion:

    • Conduct comprehensive protein-protein interaction screens to identify non-respiratory Rcf3 partners

    • Investigate potential interactions with mitochondrial quality control machinery

    • Explore connections to mitochondrial translation apparatus

  • Evolutionary analysis:

    • Compare Rcf3 function across diverse fungal species

    • Investigate whether functional homologs exist in higher eukaryotes

    • Reconstruct the evolutionary history of the Rcf protein family

  • Disease relevance:

    • Explore whether human proteins with similar functions contribute to mitochondrial disease

    • Investigate Rcf3's role in yeast models of mitochondrial disorders

    • Assess whether Rcf3 modulates cellular responses to mitochondrial stress

Given that Rcf3 affects oxygen flux through the respiratory chain by regulating cytochrome c oxidase activity , studies focusing on the molecular mechanism of this regulation would be particularly valuable.

How might understanding YBR255C-A (Rcf3) contribute to broader mitochondrial research?

Understanding Rcf3 has significant implications for broader mitochondrial research:

  • Supercomplex assembly and stability:

    • Rcf3 studies may reveal general principles of respiratory supercomplex formation

    • Understanding how supercomplex factors like Rcf3 regulate electron transfer efficiency

    • Insights into how cells maintain optimal stoichiometry between respiratory complexes

  • Mitochondrial membrane organization:

    • Rcf3 localization and dynamics may illuminate principles of inner membrane compartmentalization

    • Understanding how small membrane proteins influence the organization of large protein complexes

    • Insights into lipid-protein interactions in respiratory complex assembly

  • Regulatory networks in mitochondrial function:

    • Rcf3's role in regulating complex IV may represent broader regulatory principles

    • Understanding how cells balance respiratory efficiency with ROS production

    • Insights into how mitochondria adapt to changing metabolic demands

  • Translational implications:

    • Potential discovery of similar regulatory mechanisms in human mitochondria

    • Insights into mitochondrial dysfunction in diseases

    • Possible therapeutic targets for modulating mitochondrial activity

The study of Rcf3 and its interactions with the respiratory chain contributes to our fundamental understanding of how cells optimize energy production while minimizing potentially harmful side reactions .

What technological advances would facilitate deeper investigation of YBR255C-A (Rcf3)?

Several technological advances would significantly enhance Rcf3 research:

  • Improved structural biology techniques:

    • Cryo-EM methods optimized for membrane protein complexes

    • Advanced NMR approaches for dynamic structural analysis

    • Computational methods to model membrane protein interactions

  • Enhanced genetic tools:

    • CRISPR-based methods for precise, conditional gene regulation

    • Rapid site-directed mutagenesis platforms for comprehensive structure-function studies

    • Systems for inducible protein degradation specific to mitochondrial compartments

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize mitochondrial subcompartments

    • Single-molecule tracking to monitor Rcf3 dynamics in living cells

    • Correlative light and electron microscopy to link function with ultrastructure

  • Biochemical innovations:

    • Improved methods for isolating intact respiratory supercomplexes

    • In vitro reconstitution systems for respiratory chain components

    • Sensitive assays for measuring local ROS production and membrane potential

  • Systems biology approaches:

    • Multi-omics integration to understand the cellular response to Rcf3 perturbation

    • Machine learning models to predict protein interactions and functional relationships

    • Metabolic flux analysis to quantify the impact of Rcf3 on cellular energetics

For example, advancements in cryo-EM have already contributed significantly to understanding respiratory supercomplex structures , and further improvements could reveal the precise molecular arrangement of Rcf3 within these complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.