Recombinant Saccharomyces cerevisiae Uncharacterized Protein YDR282C, also known as YDR282C, is a protein derived from the yeast Saccharomyces cerevisiae. This protein is part of the MIOREX complex and is involved in mitochondrial organization of gene expression. The recombinant version of YDR282C is produced in Escherichia coli and is fused with a His-tag for easier purification and identification .
Source: Expressed in Escherichia coli.
Tag: N-terminal His-tag.
Protein Length: Full-length, consisting of 414 amino acids.
Form: Lyophilized powder.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: Stored at -20°C or -80°C upon receipt. Repeated freeze-thaw cycles should be avoided .
The amino acid sequence of YDR282C is crucial for understanding its structure and potential functions. The sequence is as follows:
MLSFRSLTSTFGFVSRFQIRRLGTSLSIQNLEVQDGRWKGKLATEKKTNREHKSVDTNIK TMKMLKNPKNSTRYLRRSFVPNHRKQENGRDILEDSLSKDHLKVKSCITITTGEGYDLKR CMKLLTMQGLQPTNLIPDEIVSFSYQDNGNKGDVMILGQNGSIVSWGFSESSVRNCIVPI VKAASLNPLNGEDFETEDMDYVEIEGEQDFDKLSSLDNKVTPRIACESFLSGDLIIINSL DSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHISKTRTITENISKGTKLNLRSSDALKSI GRLFLIRGKLNLYSELIETPDLYWSEPQLEEIFKNVSRYLDIGPRINILNSKLDYSTDEC RALISLLNERNSTFLEWIIIYLIAFELCFEIYHFYQKYSSYCSEPTNDDLDATK .
While specific applications of YDR282C are not widely documented, recombinant proteins like YDR282C can be used in various research contexts, including:
Protein Structure Studies: Understanding the structure of YDR282C can provide insights into its function and interactions within the cell.
Genetic Interactions: YDR282C has been identified in genetic interaction networks, suggesting potential roles in cellular processes that could be explored further .
YDR282C interacts with other proteins within Saccharomyces cerevisiae, contributing to a complex network of genetic interactions. For example, interactions with ELM1 and ELP2 have been noted, suggesting a role in broader cellular processes .
| Characteristic | Description |
|---|---|
| Species | Saccharomyces cerevisiae |
| Source | Escherichia coli |
| Tag | N-terminal His-tag |
| Protein Length | Full-length (414 amino acids) |
| Form | Lyophilized powder |
| Purity | >90% by SDS-PAGE |
| Storage | -20°C or -80°C |
| Amino Acid Sequence | Provided in Section 3 |
KEGG: sce:YDR282C
STRING: 4932.YDR282C
YDR282C (also known as RMND1 ortholog) is an uncharacterized protein in Saccharomyces cerevisiae localized to the inner mitochondrial membrane with its C-terminus facing the intermembrane space . It is the yeast ortholog of the human RMND1 gene, which has been implicated in mitochondrial protein synthesis . Immunoblot analysis has detected YDR282C as a protein of approximately 50 kDa in size when tagged with an HA epitope . Despite being classified as "uncharacterized," preliminary studies suggest its involvement in mitochondrial functions, particularly related to mitochondrial translation machinery.
YDR282C has been experimentally determined to localize to the inner mitochondrial membrane . This localization was established through mitochondrial fractionation and intramitochondrial localization studies using antibodies against epitope tags. Specifically, the C-terminus of the protein faces the intermembrane space, suggesting a potential role in communication between mitochondrial compartments or in protein transport . This orientation may be critical for understanding its function within the context of mitochondrial protein synthesis and organelle biogenesis.
Interestingly, yeast strains containing the ydr282c-null allele demonstrate a normal phenotype, including normal growth in respiration-dependent glycerol medium and unimpaired mitochondrial protein synthesis . This lack of obvious phenotype suggests possible functional redundancy with other proteins or that its role may become apparent only under specific stress conditions not typically examined in standard laboratory assays. The absence of a clear phenotype presents a challenge for functional characterization but also suggests that comparative studies under various stress conditions might reveal conditional phenotypes.
For recombinant expression of YDR282C, researchers can adapt methodologies similar to those used for other yeast proteins. Based on successful expression of yeast proteins in E. coli, the following approach can be effective:
Optimize the ribosome-binding site through site-specific mutagenesis to enhance expression in bacterial systems
Clone the gene into an expression vector with an inducible promoter (e.g., IPTG-inducible tac promoter)
Transform the construct into an appropriate E. coli strain (e.g., TG2 or BL21)
Induce expression with IPTG and purify using a combination of chromatography techniques, such as anion-exchange and hydroxyapatite gel chromatography
This approach has yielded approximately 10 mg of purified recombinant yeast protein per liter of cell culture for other yeast proteins .
To verify and characterize the subcellular localization of YDR282C, researchers should consider:
Epitope tagging: Adding HA, YFP, or similar tags to facilitate detection with commercial antibodies
Mitochondrial fractionation: Separating different mitochondrial compartments through gradient centrifugation
Immunodetection: Using epitope antibodies for Western blotting and immunocytochemistry
Fluorescence microscopy: For YFP-tagged constructs to visualize localization in living cells
When using YFP-RMND1 fusion proteins, researchers should note that immunoblot analysis typically reveals two bands: the expected long isoform (approximately 52 kDa) and a cleaved mitochondrial protein (approximately 28 kDa) .
For generating YDR282C knockout strains:
Use homologous recombination-based gene replacement with a selectable marker
Verify gene deletion through PCR analysis of genomic DNA
Confirm protein absence through Western blotting if antibodies are available
Validate the knockout by testing for phenotypes under various growth conditions, particularly those requiring respiratory function
For phenotypic characterization, examine growth in both fermentable (glucose) and non-fermentable (glycerol) carbon sources to assess respiratory capacity .
Ribosome profiling of wild-type versus knockout strains
Analysis of mitochondrial translation products using 35S-methionine labeling
Examination of potential genetic interactions through synthetic genetic arrays
Based on available data from orthologous proteins:
| Feature | Description | Position | Method of Identification |
|---|---|---|---|
| Mitochondrial targeting sequence | N-terminal signal sequence | N-terminus | Bioinformatic prediction and experimental verification |
| Transmembrane domain | Inner mitochondrial membrane anchor | Central region | Hydropathy analysis and subcellular fractionation |
| Functional domains | Potential RNA or protein interaction domains | C-terminal region | Structural homology modeling |
| Processing site | Site of proteolytic cleavage | Between N-terminal and mature protein | Observed size difference in Western blot analysis |
The detection of both 52 kDa and 28 kDa forms of the protein suggests post-translational processing, potentially through proteolytic cleavage of a precursor form after mitochondrial import .
The human ortholog of YDR282C, RMND1, has at least three isoforms produced by alternative splicing :
Isoform 1: 449 amino acids (longest form), localized to mitochondria
Isoform 2: Lacking amino acids 1-211
Isoform 3: Containing alternative amino acids 205-208 (DAAN>GTSS) and missing amino acids 209-449
While mutations in human RMND1 are associated with infantile encephaloneuromyopathy and defective mitochondrial translation, the yeast ortholog knockout shows no obvious phenotype . This difference suggests either functional divergence or the presence of compensatory mechanisms in yeast. Comparative analysis across species could reveal conserved domains critical for function and species-specific adaptations.
Yeast ghost preparation provides a unique approach for studying membrane proteins like YDR282C. The protocol involves:
Determining Minimum Inhibitory Concentration (MIC) for chemical agents (NaOH, SDS, NaHCO₃, H₂O₂)
Applying these agents at critical concentrations to create gentle pores in the yeast cell walls
Allowing cytoplasmic content evacuation while maintaining the 3D structure and membrane integrity
Verifying ghost formation through light and scanning electron microscopy
This approach preserves the membrane structure where YDR282C resides, potentially allowing for isolation of membrane protein complexes in their native orientation . The evacuation of cytoplasmic contents can be verified by measuring released DNA and protein using spectrophotometry at 260 nm and 280 nm, respectively .
For heterologous expression of YDR282C, researchers can adapt approaches used for other yeast proteins:
E. coli expression system:
Modify the ribosome-binding site to match E. coli consensus sequences
Use an inducible promoter system like the tac promoter with IPTG induction
Create fusion proteins with purification tags (His, GST, MBP) for easier purification
Expression yields of approximately 10 mg/L of culture have been achieved for other yeast proteins
Alternative host systems:
Other yeast species (Pichia pastoris for higher expression)
Mammalian cell lines (for studying interaction with mammalian orthologs)
Cell-free expression systems (for difficult-to-express proteins)
To identify and characterize protein-protein interactions:
Affinity purification coupled with mass spectrometry:
Express epitope-tagged YDR282C in yeast
Isolate mitochondria and solubilize membrane proteins
Perform pull-down experiments followed by mass spectrometry analysis
Yeast two-hybrid screening:
Use the mature form of YDR282C (post-processing) as bait
Screen against a mitochondrial protein library
Validate interactions through co-immunoprecipitation
Proximity labeling approaches:
Fuse YDR282C with BioID or APEX2 enzymes
Identify proteins in close proximity through biotinylation
Analyze biotinylated proteins by mass spectrometry
The absence of an obvious phenotype in ydr282c-null strains could be attributed to:
Functional redundancy: Other proteins may compensate for YDR282C loss
Condition-specific requirements: The protein may be important only under specific stress conditions not typically tested
Subtle phenotypes: The effects may be quantitatively small or affect processes not examined in standard assays
Evolutionary differences: The function may have diverged between yeast and higher eukaryotes
Researchers should consider examining the knockout strain under various stress conditions (oxidative stress, temperature stress, nutrient limitation) and utilizing more sensitive analytical methods (transcriptomics, metabolomics) to detect subtle phenotypic changes.
Common challenges and solutions include:
| Challenge | Cause | Solution |
|---|---|---|
| Low expression | Poor codon optimization, toxicity | Optimize codons, use tightly regulated inducible promoters |
| Insolubility | Membrane protein nature | Use mild detergents, fusion partners (MBP), lower induction temperature |
| Protein degradation | Protease sensitivity | Include protease inhibitors, use protease-deficient host strains |
| Loss of activity | Improper folding | Co-express with chaperones, optimize buffer conditions |
| Aggregation | Hydrophobic regions | Add solubilizing agents, optimize purification conditions |
When working with membrane proteins like YDR282C, consider using specialized approaches such as amphipols or nanodiscs to maintain protein structure and function during purification.
CRISPR-Cas9 technology offers several advantages for YDR282C research:
Precise genome editing:
Introduction of point mutations to study specific domains
Creation of conditional alleles through insertion of degradation tags
Integration of reporter genes for live-cell imaging
Transcriptional modulation:
CRISPRi for partial knockdown to study dosage effects
CRISPRa for overexpression studies
Timed modulation using inducible CRISPR systems
High-throughput screening:
CRISPR libraries targeting genetic interactors
Systematic mutagenesis of YDR282C domains
Parallel phenotypic analysis using pooled screens
Integrated systems biology approaches for YDR282C characterization include:
Multi-omics integration:
Combine transcriptomics, proteomics, and metabolomics of wild-type vs. knockout strains
Map changes onto biochemical pathways to identify affected processes
Identify potential biomarkers for functional assays
Network analysis:
Construct protein-protein interaction networks
Perform genetic interaction mapping through synthetic genetic arrays
Identify functional modules through co-expression analysis
Comparative genomics:
Analyze evolutionary conservation patterns
Identify co-evolved gene clusters
Leverage phenotypic data from orthologous genes in model organisms