Recombinant Saccharomyces cerevisiae Uncharacterized protein YDR366C (YDR366C)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Uncharacterized Protein YDR366C (YDR366C)

Recombinant Saccharomyces cerevisiae Uncharacterized Protein YDR366C (YDR366C) is a bioengineered version of the native YDR366C protein, expressed in E. coli for research purposes. This 132-amino acid protein (UniProt ID: P87287) remains functionally uncharacterized but has been studied for its potential roles in cellular processes, including mitochondrial localization and stress response .

Predicted Interaction Partners

YDR366C is predicted to interact with proteins involved in transport, stress response, and mitochondrial function. Key partners include:

InteractorDescriptionInteraction Score
RCH1Plasma membrane transporter; member of SLC10 carrier family; linked to azole resistance .0.758
BOP2Protein of unknown function; co-occurs with YDR366C in genomic contexts .0.700
YOL014WCytosol/nucleus-localized protein; functionally uncharacterized .0.696
YKL133CMitochondrial protein with a paralog (MGR3); role in mitochondrial genome maintenance .0.622

Subcellular Localization

  • Native YDR366C: Not required for growth of cells lacking mitochondrial DNA .

  • Recombinant YDR366C: SWAT-GFP/mCherry fusions localize to mitochondria , though some studies suggest cytosolic/nuclear distribution .

Functional Inferences

  • Stress Response: Expression of adjacent ORFs (e.g., YJL107C) is induced by mitogen-activated protein kinase (MAPK) pathways .

  • Mitochondrial Role: Paralog MGR3 (YKL133C) is implicated in mitochondrial genome maintenance, suggesting a potential indirect role .

Recombinant Protein Utilization

ApplicationDetails
Western BlottingDetected using anti-YDR366C antibodies (e.g., rabbit polyclonal antibodies) .
Protein Interaction StudiesCo-IP or pull-down assays to validate predicted partners (e.g., RCH1, BOP2) .
Structural StudiesX-ray crystallography or NMR to determine tertiary structure.

Current Knowledge Gaps

  1. Functional Annotation: No confirmed enzymatic activity or pathway assignment .

  2. Evolutionary Context: Paralogs (e.g., MGR3) may obscure functional redundancy .

  3. Experimental Validation: Predicted interactions (e.g., with RCH1) lack direct experimental evidence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
YDR366C; Uncharacterized protein YDR366C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-132
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YDR366C
Target Protein Sequence
ALHRFSRLLCTFFSKIIEEGCVWYNKKHRFPNLYKYIYVYVYILHICFEKYVNVEIIVGI PLLIKAIILGIQNILEVLLKDLGIHKRESAILHNSINIIIIILYVYIH
Uniprot No.

Target Background

Database Links

KEGG: sce:YDR366C

STRING: 4932.YDR366C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is known about the YDR366C protein in Saccharomyces cerevisiae?

YDR366C is an uncharacterized protein in Saccharomyces cerevisiae with limited functional annotation. Similar to other uncharacterized yeast genes like YBR238C, it likely participates in cellular signaling pathways that influence critical cellular processes . Based on sequence analysis, it may contain conserved domains that suggest potential molecular functions, though experimental validation remains necessary. Researchers should approach this protein with the understanding that its characterization requires systematic investigation similar to the approach used for other initially uncharacterized yeast genes.

What expression patterns does YDR366C exhibit under standard growth conditions?

YDR366C typically exhibits moderate expression levels under standard laboratory growth conditions (YPD medium, 30°C). Expression profiling using RNA-Seq methodologies, similar to those employed for characterizing genes like YBR238C, can reveal condition-specific regulation patterns . Researchers should monitor YDR366C expression across different growth phases and compare these to established housekeeping genes to determine baseline expression patterns. The protein may show differential expression under stress conditions, nutrient limitation, or specific carbon sources, providing initial clues to its functional role.

How do I obtain recombinant YDR366C protein for experimental studies?

To produce recombinant YDR366C protein, researchers should consider these methodological approaches:

  • Cloning strategy: Amplify the YDR366C gene from S. cerevisiae genomic DNA using high-fidelity PCR. Design primers with appropriate restriction sites for subsequent insertion into expression vectors.

  • Expression system selection: For eukaryotic protein expression, utilize either S. cerevisiae itself or other eukaryotic expression systems like Pichia pastoris. These systems provide appropriate post-translational modifications that may be essential for protein function.

  • Purification approach: Express the protein with an affinity tag (His6, GST, or FLAG) to facilitate purification using standard chromatography techniques.

  • Verification methods: Confirm successful expression and purification using SDS-PAGE, Western blotting, and mass spectrometry for protein identity validation.

What deletion/knockout strategies are most effective for studying YDR366C function?

When designing YDR366C deletion studies, consider these methodological approaches:

  • CRISPR-Cas9 methodology: This provides precise gene editing capabilities for creating clean deletions with minimal off-target effects.

  • Homologous recombination: Traditional approach using selection markers (URA3, LEU2) flanked by YDR366C homologous sequences.

  • Conditional systems: Consider implementing temperature-sensitive mutants or auxin-inducible degron systems if complete deletion proves lethal.

  • Verification protocols: Confirm successful deletion through PCR genotyping, sequencing, and expression analysis (RT-qPCR, Western blotting).

The experimental design should include comprehensive phenotypic characterization of the deletion strain, including growth rates under various conditions, stress responses, and morphological changes – similar to approaches documented for other uncharacterized yeast genes .

How should I design experiments to identify potential interaction partners of YDR366C?

To identify interaction partners of YDR366C, implement these methodological approaches:

Table 1
Methods for Identifying YDR366C Protein Interaction Partners

MethodExperimental ApproachAdvantagesLimitationsData Output
Yeast Two-Hybrid (Y2H)Express YDR366C as bait to screen against prey libraryHigh-throughput capability; in vivo detectionFalse positives; limited to nuclear interactionsBinary interaction data
Affinity Purification-Mass SpectrometryExpress tagged YDR366C, purify complexes, identify by MSIdentifies native complexes; quantitativeMay lose transient interactionsProtein complex composition
Proximity Labeling (BioID/APEX)Express YDR366C fused to biotin ligase, identify biotinylated proteinsCaptures weak/transient interactions; in vivoPotential false positives from proximitySpatial interaction network
Genetic Interaction ScreensSynthetic genetic array analysis with YDR366C deletionFunctional relationships; no physical interaction requiredLabor-intensive; indirect relationshipsGenetic interaction scores

When analyzing interaction data, prioritize proteins appearing across multiple methodologies, and validate key interactions using co-immunoprecipitation or fluorescence microscopy to visualize co-localization. Network analysis tools can help identify functional modules related to YDR366C.

What are the best methods for investigating YDR366C subcellular localization?

For determining YDR366C subcellular localization, consider these methodological approaches:

  • Fluorescent protein tagging: Generate C-terminal or N-terminal GFP/mCherry fusions, ensuring proper protein folding and function. Verify that tagging doesn't disrupt native localization patterns.

  • Immunofluorescence microscopy: Develop specific antibodies against YDR366C or its tags for fixed-cell imaging with co-localization markers.

  • Subcellular fractionation: Isolate cellular compartments (mitochondria, nucleus, ER) followed by Western blot analysis to determine YDR366C distribution.

  • Co-localization studies: Use established organelle markers to determine precise subcellular compartments where YDR366C resides.

  • Live-cell imaging: Monitor dynamic localization changes in response to environmental stimuli or throughout the cell cycle.

Document localization patterns using high-resolution microscopy with appropriate controls and quantification metrics, similar to approaches used for characterizing other yeast proteins.

How does YDR366C expression change under various stress conditions?

To characterize YDR366C expression under stress conditions, researchers should implement a systematic approach:

Table 2
YDR366C Expression Profiling Under Various Stress Conditions

Stress ConditionExperimental SetupAnalysis MethodExpected OutcomesControl Genes
Oxidative stressH₂O₂ (0.5-3mM), 15-120 minRT-qPCR, RNA-SeqExpression fold changeCTT1, GSH1
Nutrient limitationCarbon/nitrogen depletionRT-qPCR, Western blotProtein/mRNA levelsSNF1, TOR1
Temperature stressHeat shock (37-42°C)Microarray, proteomicsTemporal expression patternHSP82, SSA1
Osmotic stressNaCl (0.4-1.0M)Northern blot, RNA-SeqRapid response kineticsHOG1, GPD1
ER stressTunicamycin (1-2μg/ml)RNA-Seq, ribosome profilingTranslational regulationHAC1, KAR2

When analyzing expression data, normalize YDR366C expression to stable reference genes appropriate for each condition, and employ statistical analysis to determine significant changes. Compare expression patterns with genes of known function to identify potential co-regulated networks, similar to approaches used in studies of other uncharacterized yeast genes .

Is YDR366C expression regulated by TORC1 signaling pathways?

Given the critical role of TORC1 (Target of Rapamycin Complex 1) in regulating yeast growth and metabolism, investigating YDR366C's relationship to this pathway is valuable:

  • Rapamycin treatment: Expose cells to rapamycin (200ng/ml) and monitor YDR366C expression changes using RNA-Seq or RT-qPCR. Compare results with known rapamycin-responsive genes to determine if YDR366C belongs to rapamycin upregulated genes (RUG) or rapamycin downregulated genes (RDG) .

  • Nutrient sensing: Analyze YDR366C expression in response to nitrogen quality changes or amino acid availability, which directly affect TORC1 activity.

  • Genetic approaches: Examine YDR366C expression in strains with mutations in TORC1 pathway components (TOR1, SCH9, TAP42) to identify regulatory relationships.

  • Phosphoproteomics: Determine if YDR366C is directly phosphorylated by TORC1 or its downstream kinases, suggesting direct regulation.

Similar to YBR238C, which was characterized as a TORC1 signaling effector , YDR366C might function within cellular signaling networks influenced by nutrient availability and stress responses.

What phenotypes are associated with YDR366C deletion or overexpression?

Comprehensive phenotypic characterization is essential for understanding YDR366C function:

  • Growth phenotypes: Measure growth rates of deletion and overexpression strains under various conditions (temperature, carbon sources, stress agents) using automated growth curve analysis.

  • Cellular morphology: Evaluate changes in cell size, shape, budding patterns, and ultrastructure using light microscopy, electron microscopy, and flow cytometry.

  • Organelle dynamics: Assess mitochondrial morphology and function, vacuolar structure, and endoplasmic reticulum organization using fluorescent markers and cellular staining techniques.

  • Lifespan analysis: Measure replicative and chronological lifespan to determine if YDR366C influences aging processes, similar to analyses performed for other uncharacterized genes like YBR238C .

  • Metabolic profiling: Analyze changes in central carbon metabolism, lipid composition, and energy production that might result from YDR366C perturbation.

Document all phenotypic data systematically in tables showing quantitative measurements with appropriate statistical analysis and significance levels.

How can I determine if YDR366C is involved in mitochondrial function?

Given that many uncharacterized yeast proteins affect mitochondrial processes, investigating YDR366C's potential role in mitochondrial function requires multiple approaches:

  • Respiratory competence: Compare growth of wild-type and YDR366C mutant strains on fermentable (glucose) versus non-fermentable (glycerol, ethanol) carbon sources to assess respiratory capacity.

  • Mitochondrial membrane potential: Use fluorescent dyes like TMRM or JC-1 to measure membrane potential changes in YDR366C mutants, indicating potential roles in energy production.

  • ROS production: Quantify reactive oxygen species levels using specific probes (DCF-DA, MitoSOX) to determine if YDR366C affects mitochondrial ROS regulation.

  • mtDNA stability: Assess mitochondrial DNA copy number and mutation rate in YDR366C mutants to identify potential roles in mtDNA maintenance.

  • Mitochondrial protein import: Evaluate the efficiency of protein import into mitochondria using reporter constructs to determine if YDR366C affects import machinery function.

Similar to approaches used for characterizing YBR238C's role in mitochondrial feedback loops , these methods can reveal whether YDR366C participates in mitochondrial processes.

How can systems biology approaches help characterize YDR366C function?

Systems biology offers powerful frameworks for uncovering functions of uncharacterized proteins like YDR366C:

  • Network integration: Combine data from protein-protein interactions, genetic interactions, co-expression patterns, and metabolic profiles to position YDR366C within functional networks. Utilize data visualization tools to identify biological modules containing YDR366C.

  • Multi-omics analysis: Integrate transcriptomics, proteomics, metabolomics, and phenomics data from YDR366C mutants to construct comprehensive functional models. This approach can reveal emergent properties not obvious from single-method analyses.

  • Evolutionary analyses: Perform comparative genomics across fungal species to identify conservation patterns and potential functional constraints on YDR366C, providing evolutionary context for its role.

  • Mathematical modeling: Develop predictive models incorporating YDR366C into known cellular pathways to generate testable hypotheses about its function under various conditions.

  • Machine learning applications: Apply supervised learning algorithms to predict YDR366C function based on features shared with characterized proteins, then validate predictions experimentally.

These integrative approaches have successfully revealed functions of previously uncharacterized genes in S. cerevisiae and can be applied to elucidate YDR366C's biological role.

What are the best approaches for creating structure-function relationships for YDR366C?

Understanding the structure-function relationship of YDR366C requires a multifaceted approach:

  • Structural prediction: Utilize computational tools (AlphaFold2, RoseTTAFold) to generate predicted structural models of YDR366C. Compare these predictions with known protein structures to identify potential functional domains.

  • Domain mapping: Create a series of truncation and point mutations to identify functional regions essential for YDR366C activity, complementing computational predictions with experimental data.

  • Post-translational modifications: Map phosphorylation, ubiquitination, and other modifications that might regulate YDR366C function using mass spectrometry-based proteomics.

  • Protein engineering: Design chimeric proteins combining domains from YDR366C with those from functionally characterized proteins to test domain functionality.

  • Crystallography/Cryo-EM: For definitive structural characterization, pursue X-ray crystallography or cryo-electron microscopy of purified YDR366C protein, potentially in complex with interaction partners.

Structure-based functional annotation can reveal mechanistic insights that biochemical approaches alone might miss, particularly for proteins with novel structural features.

What are the most reliable methods for preparing S. cerevisiae ghost cells expressing YDR366C for drug delivery applications?

The preparation of S. cerevisiae ghost cells expressing YDR366C requires careful methodological considerations:

  • Sponge-Like Protocol adaptation: Apply the Sponge-Like protocol, which has been successfully used for yeast ghost preparation , with modifications for YDR366C-expressing strains:

    a. Determine the Minimum Inhibitory Concentration (MIC) of chemical agents (NaOH, SDS, NaHCO₃, H₂O₂) specifically for your YDR366C-expressing strain

    b. Apply these agents sequentially to create pores in the cell wall while preserving the 3D structure

    c. Use decantation rather than centrifugation to avoid cell deformation, as recommended for yeast ghost preparation

  • Quality control assessment:

    a. Confirm successful ghost preparation using scanning electron microscopy to visualize cell structure and pore formation

    b. Verify DNA and protein release using spectrophotometric measurements at 260nm and 280nm

    c. Validate YDR366C retention in the membrane fraction using Western blotting if the protein is membrane-associated

  • Functional validation: Test prepared ghost cells for structural integrity, lack of cytoplasmic content, and retention of YDR366C at the cell surface when applicable.

This approach builds on established protocols while accommodating the specific characteristics of YDR366C-expressing strains .

How should I analyze and present RNA-Seq data investigating YDR366C expression changes?

For analyzing and presenting RNA-Seq data on YDR366C expression:

  • Data processing pipeline:

    a. Quality control: Use FastQC for raw read quality assessment

    b. Alignment: Map reads to S. cerevisiae reference genome using STAR or HISAT2

    c. Quantification: Calculate expression levels using HTSeq-count or featureCounts

    d. Differential expression: Analyze using DESeq2 or edgeR with appropriate statistical thresholds

  • Data presentation guidelines:

Table 3
YDR366C Differential Expression Under Various Conditions

ConditionMean CountLog2 Fold Changep-valueAdjusted p-valueCo-regulated Genes
Condition 112452.40.00020.0015Gene1, Gene2, Gene3
Condition 2987-1.80.00080.0042Gene4, Gene5
Condition 315670.50.34210.4532None significant
  • Validation approaches:

    a. Confirm key expression changes using RT-qPCR

    b. Correlate mRNA changes with protein levels when possible

    c. Compare expression patterns with publicly available datasets

  • Functional enrichment analysis:

    a. Identify biological processes enriched among co-regulated genes

    b. Map expression changes to known pathways using tools like KEGG and GO

Following appropriate data table formatting guidelines and including both statistical significance and biological relevance in your presentation will enhance the interpretability of your findings.

How does YDR366C compare to other uncharacterized yeast proteins?

A comparative analysis between YDR366C and other uncharacterized yeast proteins provides valuable context:

  • Sequence-based comparison: Perform sequence alignment with other uncharacterized proteins (like YBR238C ) to identify shared domains or motifs that might suggest functional similarities.

  • Expression pattern analysis: Compare expression profiles across various conditions to identify co-regulated uncharacterized genes that might function in the same pathways.

  • Phenotypic comparison: Systematically compare deletion phenotypes of multiple uncharacterized proteins to identify shared or distinct functional categories.

  • Evolutionary conservation: Analyze conservation patterns across fungal species to determine if YDR366C belongs to evolutionarily conserved families like other characterized proteins.

This comparative approach can identify functional relationships between YDR366C and other proteins of unknown function, potentially revealing shared regulatory mechanisms or biological processes.

What bioinformatic approaches can predict YDR366C function based on sequence analysis?

Advanced bioinformatic approaches can provide functional predictions for YDR366C:

  • Domain architecture analysis: Identify known domains, motifs, and functional sites using tools like InterPro, PFAM, and PROSITE.

  • Secondary structure prediction: Apply algorithms like PSIPRED to predict structural elements that might suggest functional capabilities.

  • Homology modeling: Generate structural models based on distant homologs to infer potential binding sites or catalytic regions.

  • Protein-protein interaction prediction: Use computational tools to predict potential interaction partners based on co-evolution patterns, structural compatibility, or sequence features.

  • Functional annotation transfer: Apply machine learning algorithms that integrate multiple features to transfer functional annotations from characterized proteins to YDR366C.

These computational predictions should serve as the foundation for experimental validation, similar to approaches used for characterizing other uncharacterized yeast genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.