Recombinant Saccharomyces cerevisiae Uncharacterized protein YEL045C (YEL045C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please inform us, and we will prioritize its development.
Synonyms
YEL045C; SYGP-ORF33; Uncharacterized protein YEL045C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YEL045C
Target Protein Sequence
MKCHAKRTLAFLATALPLSGKSRACTRTPQSFASGFRAAAPFLFSRCFALCITHCALFHL PYSFTGFSFYFFVFFRLFLHWIYAFCICNSTYVYIYKQVLSLPVKSSMCPSRLSCSVWYR VILTYIYVHCFRWLVRNHLLS
Uniprot No.

Target Background

Function
Essential for optimal growth under alkaline conditions.
Database Links

STRING: 4932.YEL045C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Which methods are most effective for expressing recombinant YEL045C? [BASIC]

Expression of recombinant YEL045C can be achieved through standard protein expression systems, with E. coli being a common choice for initial characterization studies. The protein's relatively small size (102 amino acids) makes it amenable to bacterial expression systems .

For expression protocol optimization:

  • Use BL21(DE3) or similar E. coli strains optimized for protein expression

  • Consider adding a purification tag (His6, GST, or MBP) to facilitate downstream purification

  • Test expression at different temperatures (16°C, 25°C, 37°C) to optimize solubility

  • Validate expression through SDS-PAGE and Western blotting

For researchers requiring native post-translational modifications, consider yeast-based expression systems like Pichia pastoris or S. cerevisiae itself, which may preserve functional characteristics lost in bacterial systems.

How does YEL045C compare structurally to other yeast proteins? [ADVANCED]

Structural comparison of YEL045C with characterized yeast proteins reveals limited homology to known functional domains, contributing to its uncharacterized status. Computational structure prediction suggests the protein may contain alpha-helical regions that could facilitate protein-protein interactions .

To conduct thorough structural comparisons:

  • Perform sequence-based structural predictions using tools like SWISS-MODEL, Phyre2, or AlphaFold

  • Analyze predicted secondary structure elements for functional motifs

  • Conduct comparative analyses with proteins of similar size and composition

  • Look for conserved regions across fungal species that might indicate functional domains

The absence of clearly identifiable functional domains underscores the need for experimental structure determination through techniques such as X-ray crystallography or NMR spectroscopy to fully understand YEL045C's potential functions.

What are the best genetic approaches to study YEL045C function? [BASIC]

To investigate YEL045C function, employ a multi-faceted genetic approach:

  • Gene deletion analysis:

    • Generate YEL045C knockout strains using homologous recombination-based techniques

    • Compare growth phenotypes across various conditions (temperature, pH, osmotic stress)

    • Assess sensitivity to DNA damaging agents (UV, MMS, hydroxyurea)

  • Overexpression studies:

    • Create strains with YEL045C under control of inducible promoters (GAL1, CUP1)

    • Monitor effects on cellular processes, particularly those related to DNA metabolism

  • Synthetic genetic interactions:

    • Perform synthetic genetic array (SGA) analysis by crossing YEL045C deletion with genome-wide deletion collection

    • Identify genetic interactions that could reveal pathway associations

  • Localization studies:

    • Generate GFP-tagged versions of YEL045C to determine subcellular localization

    • Monitor localization changes in response to different cellular stresses

This methodical approach facilitates functional characterization while minimizing experimental artifacts that could lead to misinterpretation of results.

How can systematic screening approaches help characterize YEL045C? [ADVANCED]

Systematic screening approaches offer powerful methodologies for functionally characterizing uncharacterized proteins like YEL045C:

  • High-throughput phenotypic screening:

    • Assess YEL045C deletion strain across hundreds of growth conditions using automated platforms

    • Quantify fitness defects to identify condition-specific requirements for YEL045C function

    • Compare phenotypic signatures with known genes to predict functional relationships

  • Chemical-genetic profiling:

    • Expose YEL045C deletion strains to libraries of chemical compounds

    • Identify specific chemical sensitivities that suggest biochemical pathways

    • Use chemogenomic signatures to position YEL045C in cellular networks

  • Protein-protein interaction mapping:

    • Employ techniques such as affinity purification-mass spectrometry (AP-MS)

    • Implement BioID or APEX proximity labeling to capture transient interactions

    • Validate key interactions through orthogonal methods (Y2H, co-IP)

  • Transcriptional response analysis:

    • Perform RNA-seq comparing wild-type and YEL045C knockout strains

    • Analyze differential gene expression patterns to infer regulatory relationships

    • Conduct analyses under both standard and stress conditions

These comprehensive screening approaches have successfully characterized numerous previously uncharacterized yeast proteins and can reveal unexpected functions that targeted approaches might miss .

What challenges might researchers encounter when studying YEL045C and how can they be overcome? [ADVANCED]

Researchers studying YEL045C face several methodological challenges:

  • Functional redundancy issues:

    • Challenge: Absence of phenotype in YEL045C deletion strains due to functional compensation

    • Solution: Generate double or triple mutants with functionally related genes

    • Approach: Utilize chemical-genetic synthetic lethality screens to identify compensatory pathways

  • Temporal expression challenges:

    • Challenge: YEL045C may only be expressed or functionally important under specific conditions

    • Solution: Assess function across diverse environmental conditions and cell cycle stages

    • Approach: Implement time-course experiments following environmental perturbations

  • Protein stability and detection difficulties:

    • Challenge: Low abundance or rapid turnover of YEL045C protein

    • Solution: Use epitope tagging with stabilizing elements or degron-based approaches

    • Approach: Employ tandem affinity purification with sensitive detection methods

  • Data interpretation complexities:

    • Challenge: Contradictory results from different experimental approaches

    • Solution: Implement orthogonal validation strategies to resolve contradictions

    • Approach: Triangulate findings using genetic, biochemical, and computational evidence

These methodological solutions have proven effective for characterizing other challenging yeast proteins and can help overcome the inherent difficulties in studying uncharacterized proteins like YEL045C.

How is YEL045C potentially involved in recombination processes? [ADVANCED]

While YEL045C's precise role in recombination remains unclear, several lines of evidence suggest potential involvement:

  • Genetic screen findings:

    • YEL045C appears in screens for genes affecting recombination rates in yeast

    • Its deletion may alter spontaneous direct recombination frequencies, though the effect size requires further validation

  • Potential mechanistic roles:

    • YEL045C might function in regulating DNA double-strand break formation

    • It could participate in homologous recombination pathway choice

    • The protein may influence chromatin states that affect recombination efficiency

  • Experimental approaches to test recombination involvement:

    • Quantify recombination rates using reporter systems (e.g., direct-repeat recombination assays)

    • Measure sister chromatid exchange frequencies in YEL045C mutants

    • Assess synthetic genetic interactions with known recombination genes (RAD52, RAD51)

    • Monitor DNA damage-induced recombination in the presence/absence of YEL045C

  • Comparative analysis with characterized recombination factors:

    • Compare YEL045C deletion phenotypes with those of established recombination proteins

    • Assess co-localization with recombination machinery during meiosis or after DNA damage

    • Evaluate physical interactions with recombination proteins through co-immunoprecipitation

These methodologies can help position YEL045C within the complex network of proteins that regulate recombination in yeast .

What methods can be used to investigate YEL045C's potential role in DNA damage repair? [ADVANCED]

To rigorously investigate YEL045C's potential role in DNA damage repair:

  • DNA damage sensitivity profiling:

    • Test YEL045C deletion strain's sensitivity to various DNA damaging agents:

      Damaging AgentMechanismControl StrainAssessment Method
      UV radiationThymine dimersrad14ΔSurvival curves
      Methyl methanesulfonateAlkylationmag1ΔSpot dilution assays
      HydroxyureaReplication stressmrc1ΔGrowth curves
      Ionizing radiationDouble-strand breaksrad52ΔColony formation
      CamptothecinTopoisomerase I inhibitiontop1ΔMicroscopy for Rad52 foci
  • DNA repair kinetics assessment:

    • Monitor repair of specific DNA lesions in wild-type vs. YEL045C mutants

    • Employ techniques such as comet assay, pulse-field gel electrophoresis, or ChIP-seq for γH2AX

    • Quantify repair efficiency at different time points after damage induction

  • Pathway-specific assays:

    • Homologous recombination: Direct-repeat recombination systems

    • Non-homologous end joining: Plasmid rejoining assays

    • Nucleotide excision repair: UV damage repair measurement

    • Base excision repair: Alkylation damage recovery assessment

  • Epistasis analysis:

    • Generate double mutants with key DNA repair pathway components

    • Determine whether YEL045C functions within established pathways or represents a novel repair mechanism

    • Quantify phenotypic outcomes using standardized assays to position YEL045C in repair hierarchies

These methodological approaches provide a systematic framework for investigating YEL045C's function in DNA damage response pathways, allowing researchers to distinguish between direct and indirect roles.

How does YEL045C interact with the RAD52 epistasis group? [ADVANCED]

The potential interaction between YEL045C and the RAD52 epistasis group, which is central to homologous recombination in yeast, requires careful experimental validation:

  • Genetic interaction analysis:

    • Double mutant growth phenotypes can reveal functional relationships:

      Double MutantGrowth PhenotypeInterpretation
      yel045cΔ rad52ΔMore severe than single mutantsParallel pathway
      yel045cΔ rad52ΔSimilar to rad52ΔRAD52 epistatic to YEL045C
      yel045cΔ rad52ΔSimilar to yel045cΔYEL045C epistatic to RAD52
      yel045cΔ rad52ΔLess severe than expectedSuppression relationship
  • DNA damage response assays:

    • Compare recombination rates and repair kinetics in single and double mutants

    • Determine if YEL045C deletion alters Rad52 focus formation after DNA damage

    • Assess whether YEL045C function depends on RAD52 or other members of its epistasis group

  • Biochemical interaction studies:

    • Co-immunoprecipitation experiments to detect physical interactions

    • Proximity labeling approaches to identify potential transient interactions

    • In vitro reconstitution assays to test direct functional relationships

  • Chromatin association patterns:

    • ChIP-seq to determine if YEL045C and RAD52 group proteins co-localize at specific genomic loci

    • Sequential ChIP to assess whether they occupy the same DNA regions simultaneously

    • Time-course experiments to determine recruitment order to damage sites

These methodological approaches can resolve apparent contradictions in genetic interaction data and determine whether YEL045C functions upstream, downstream, or in parallel to the RAD52 epistasis group in DNA repair processes .

How can systems biology approaches help characterize YEL045C function? [BASIC]

Systems biology offers powerful approaches to characterize uncharacterized proteins like YEL045C:

  • Network-based function prediction:

    • Integrate YEL045C into protein-protein interaction networks

    • Apply "guilt by association" principles to infer function from network neighbors

    • Use algorithms like GeneMANIA or STRING to generate functional hypotheses

  • Transcriptional co-regulation analysis:

    • Identify genes co-expressed with YEL045C across diverse conditions

    • Analyze promoter regions for shared regulatory elements

    • Construct condition-specific co-expression networks to identify functional modules

  • Metabolic impact assessment:

    • Measure metabolomic changes in YEL045C deletion strains

    • Integrate findings with flux balance analysis models

    • Identify metabolic pathways potentially affected by YEL045C function

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, and phenomics data

    • Apply machine learning approaches to predict functional associations

    • Visualize integrated data using tools like Cytoscape for pattern identification

These methodologies enable researchers to place YEL045C within a broader cellular context, generating testable hypotheses about its function even in the absence of direct experimental evidence.

What computational tools are most effective for predicting YEL045C function? [BASIC]

Several computational approaches can effectively predict potential functions for uncharacterized proteins like YEL045C:

  • Sequence-based prediction tools:

    • InterProScan: Identify functional domains and motifs

    • BLAST and PSI-BLAST: Detect distant homologs with known functions

    • Phyre2 and I-TASSER: Generate structural models to infer function

    • SignalP and TMHMM: Predict cellular localization signals

  • Network-based function prediction:

    • FunctionalNet and STRING: Integrate multiple data types to build functional networks

    • GeneMANIA: Predict function based on composite functional networks

    • YeastNet: Yeast-specific functional gene networks

  • Function prediction algorithms:

    • SIFTER: Statistical approach using phylogenomics

    • FFPred: Feature-based function prediction from sequence

    • DeepGOPlus: Deep learning approach for Gene Ontology term prediction

  • Implementation strategy for YEL045C:

    • Begin with sequence-based tools to identify conserved elements

    • Apply multiple prediction methods and look for consensus

    • Integrate predictions with experimental data from similar proteins

    • Prioritize testing of high-confidence predicted functions in laboratory validation

This multi-tool approach reduces the risk of false predictions while maximizing the chance of identifying biologically relevant functions for experimental validation .

How can one resolve contradictory data about YEL045C from different systems biology experiments? [ADVANCED]

Resolving contradictory data about YEL045C requires a systematic approach:

  • Data quality assessment methodology:

    • Evaluate experimental design rigor for each contradictory dataset

    • Assess statistical power and reproducibility of each experiment

    • Review normalization methods and potential batch effects

    • Consider platform-specific biases that might influence results

  • Context-dependent function analysis:

    • Determine if contradictions arise from different experimental conditions

    • Create a condition-specific functional map for YEL045C

    • Test whether YEL045C function varies across growth phases or stress responses

    • Implement time-course experiments to capture dynamic functional changes

  • Multi-level data integration strategy:

    • Weight evidence based on experimental robustness

    • Implement Bayesian integration methods to resolve conflicting observations

    • Apply ensemble approaches that combine multiple independent analyses

    • Develop computational models that can account for context-dependent functions

  • Targeted validation experiments:

    • Design experiments specifically addressing contradictory points

    • Implement orthogonal techniques to validate key findings

    • Use CRISPR-based approaches for precise functional perturbation

    • Collaborate with specialists in relevant technical domains

These methodological approaches have successfully resolved apparent contradictions in systems biology data for other yeast proteins and can help construct a coherent functional model for YEL045C despite initially conflicting observations .

How can YEL045C be studied in the context of experimental evolution? [ADVANCED]

Experimental evolution provides a powerful framework for understanding the functional significance of YEL045C:

  • Experimental evolution design for YEL045C studies:

    • Maintain parallel populations of wild-type and YEL045C mutant strains under selective pressure

    • Apply DNA damage agents at sub-lethal doses to select for compensatory adaptations

    • Monitor evolutionary trajectories using time-point sampling and sequencing

    • Compare adaptation rates and molecular solutions between genotypes

  • Analytical approaches:

    • Whole-genome sequencing to track mutations across evolved populations

    • Competitive fitness assays to quantify adaptive improvements

    • Transcriptome analysis to identify regulatory rewiring

    • Genetic reconstruction to validate adaptive mutations

  • Specific experimental design parameters:

    ParameterRecommendationRationale
    Population size>10^7 cellsEnsures access to rare beneficial mutations
    Replicate populations≥10Distinguishes stochastic from deterministic outcomes
    Duration>500 generationsAllows secondary adaptations to emerge
    Sampling frequencyEvery 50-100 generationsCaptures evolutionary dynamics
    Preservation methodGlycerol stocks at -80°CEnables revival of ancestral populations
  • Interpretation framework:

    • Identify parallel evolution events that suggest strong selection

    • Analyze mutational pathways unique to YEL045C mutant backgrounds

    • Determine if adaptive solutions compensate for or bypass YEL045C function

    • Use network analysis to map evolutionary trajectories to functional pathways

This evolutionary approach can reveal YEL045C's functional importance under different selective regimes and identify genetic interactions not apparent in static genetic analyses.

What considerations are important when including YEL045C in synthetic recombinant yeast populations? [ADVANCED]

When incorporating YEL045C variants in synthetic recombinant yeast populations, several methodological considerations are crucial:

  • Population construction strategies:

    • "R-type" approach: Random mating of diverse haploid cells, simpler but less controlled

    • "S-type" approach: Systematic crossing design with spore isolation, more laborious but ensures better founder representation

    • Selection of approach depends on research objectives and required genetic diversity

  • Founder strain selection considerations:

    • Include strains with natural YEL045C variants to capture functional diversity

    • Consider using 8-12 founder strains to maximize genetic variation

    • Balance between laboratory and wild isolates to represent natural diversity

    • Screen for compatibility issues that might bias representation

  • Recombination promotion methodology:

    • Implement mating cycles with sporulation to increase recombination events

    • Monitor YEL045C haplotype frequencies throughout population construction

    • Consider using selectable markers linked to different YEL045C alleles

    • Validate final haplotype distribution using targeted sequencing

  • Quality control metrics:

    • Sequencing-based verification of founder representation

    • Assessment of linkage disequilibrium patterns around YEL045C

    • Confirmation of population stability across generations

    • Validation of expected segregation patterns for known markers

These methodological approaches ensure that synthetic recombinant populations appropriately capture the genetic diversity needed to study YEL045C function in complex genetic backgrounds that better represent natural variation .

How does YEL045C contribute to recombination dynamics in synthetic yeast populations? [ADVANCED]

Understanding YEL045C's contribution to recombination dynamics requires specialized experimental designs:

  • Recombination rate measurement approaches:

    • Direct measurement using flanking selectable markers

    • PCR-based detection of recombination events at specific loci

    • Whole-genome sequencing to map recombination landscapes

    • Fluorescent reporter systems to visualize recombination in real-time

  • YEL045C variant analysis methodology:

    • Create synthetic populations with different natural YEL045C variants

    • Measure position-specific recombination rates across populations

    • Identify potential recombination hotspots or coldspots associated with YEL045C alleles

    • Correlate YEL045C expression levels with recombination frequencies

  • Experimental design for meiotic recombination studies:

    • Diploid strain construction with heterozygous YEL045C alleles

    • Tetrad dissection and genotyping to map crossover events

    • Comparison of wild-type and YEL045C mutant recombination patterns

    • Immunofluorescence visualization of recombination proteins during meiosis

  • Population-level recombination dynamics:

    • Track haplotype block persistence around YEL045C locus over generations

    • Measure linkage disequilibrium decay rates in the presence of different YEL045C alleles

    • Assess whether YEL045C variants influence global or local recombination patterns

    • Determine if recombination effects are condition-dependent

These methodological approaches can clarify whether YEL045C plays a direct role in regulating recombination processes or if observed effects are indirect consequences of other cellular functions .

What are the most promising research directions for understanding YEL045C function? [BASIC]

The most promising research directions for YEL045C functional characterization include:

  • Integrative functional genomics approach:

    • Combine genome-wide genetic interaction screens with physical interaction mapping

    • Implement CRISPR-based functional screens in diverse conditions

    • Apply comparative genomics across fungal species to identify conserved functions

    • Develop high-resolution localization studies to determine subcellular activity sites

  • Mechanistic biochemical characterization:

    • Express and purify YEL045C for in vitro functional assays

    • Perform structure determination through crystallography or cryo-EM

    • Identify potential binding partners and substrates

    • Characterize post-translational modifications that regulate activity

  • Physiological relevance investigation:

    • Determine condition-specific requirements for YEL045C function

    • Assess impact on cellular fitness under various stress conditions

    • Investigate potential roles in specialized cellular processes

    • Examine functional conservation in pathogenic fungi

  • Technological innovation applications:

    • Implement CRISPR-based visualization techniques for real-time monitoring

    • Apply single-cell approaches to capture population heterogeneity

    • Develop biosensors to detect YEL045C activity in vivo

    • Use synthetic biology approaches to create conditional alleles

These research directions leverage cutting-edge technologies while addressing fundamental questions about YEL045C function, providing multiple avenues for significant discoveries .

How can contradictory findings about YEL045C be reconciled? [ADVANCED]

Reconciling contradictory findings about YEL045C requires a methodical approach:

  • Systematic review and meta-analysis methodology:

    • Catalog all experimental findings related to YEL045C with methodological details

    • Identify patterns in contradictions (e.g., strain background, experimental conditions)

    • Weigh evidence based on methodological robustness and reproducibility

    • Develop falsifiable models that could explain apparent contradictions

  • Context-dependent function investigation:

    • Test YEL045C function across precisely defined conditions:

      Condition VariableMeasurement ApproachControl Groups
      Cell cycle phaseSynchronized culturesCell cycle mutants
      Nutrient availabilityDefined media variationsMetabolic pathway mutants
      DNA damage typesChemical and physical agentsRepair pathway mutants
      Genetic backgroundIsogenic panel testingStrain-specific controls
  • Targeted experimental design to address contradictions:

    • Implement standardized protocols across laboratories

    • Conduct blind replicate studies with shared reagents

    • Develop quantitative assays with internal controls

    • Establish collaborative validation experiments

  • Computational modeling approach:

    • Develop mathematical models incorporating condition-dependent functions

    • Simulate cellular behaviors under different parameter sets

    • Identify parameter ranges that reconcile contradictory observations

    • Test model predictions with targeted experiments

These methodological approaches have successfully resolved contradictions for other poorly characterized yeast genes and can provide a framework for synthesizing a coherent functional model for YEL045C .

What collaborative approaches might accelerate understanding of YEL045C? [BASIC]

Collaborative approaches can significantly accelerate YEL045C characterization:

  • Interdisciplinary research consortium development:

    • Combine expertise in genetics, biochemistry, computational biology, and structural biology

    • Establish shared protocols and reagent repositories

    • Implement regular data-sharing and integration meetings

    • Develop complementary research objectives among participating labs

  • Technology sharing platform creation:

    • Establish a common repository for YEL045C-related strains and plasmids

    • Share specialized equipment across institutions

    • Develop standardized assay protocols to ensure data comparability

    • Create a centralized database for YEL045C-related data

  • Distributed experimentation network:

    • Divide complex experimental pipelines among specialized laboratories

    • Implement parallel validation studies across multiple research groups

    • Conduct multi-site phenotypic screens under diverse conditions

    • Pool resources for expensive or specialized analyses

  • Open science implementation:

    • Preregister study designs to reduce publication bias

    • Share protocols through platforms like protocols.io

    • Deposit raw data in public repositories prior to publication

    • Establish a YEL045C-specific research community with regular virtual meetings

These collaborative approaches leverage distributed expertise and resources while minimizing redundant efforts, potentially accelerating discoveries about YEL045C function beyond what individual laboratories could achieve independently .

What are the best methods for generating YEL045C mutants for functional studies? [BASIC]

Generating high-quality YEL045C mutants requires careful methodological considerations:

  • Complete gene deletion methodology:

    • PCR-based gene replacement with selectable markers

    • CRISPR/Cas9-mediated knockout for marker-free deletion

    • Verification through PCR, Sanger sequencing, and phenotypic assays

    • Construction in multiple strain backgrounds to control for genetic interactions

  • Point mutation generation approaches:

    • CRISPR/Cas9-mediated base editing for precise nucleotide changes

    • Delitto perfetto method for scarless genomic modifications

    • Site-directed mutagenesis in plasmid-borne copies followed by integration

    • Design mutations based on sequence conservation or structural predictions

  • Conditional allele creation:

    • Temperature-sensitive alleles through random or targeted mutagenesis

    • Degron-based approaches for inducible protein degradation

    • Promoter replacement with regulatable alternatives (GAL1, TET)

    • Anchor-away systems for conditional protein relocalization

  • Validation strategy:

    • Confirm genetic alterations through sequencing

    • Verify protein expression changes via Western blotting

    • Check for unintended off-target effects through whole-genome sequencing

    • Ensure genetic background consistency across experimental strains

These methodological approaches provide researchers with a comprehensive toolkit for generating various YEL045C mutants tailored to specific experimental questions, enabling precise dissection of protein function .

What resources and databases are most valuable for YEL045C research? [BASIC]

Researchers studying YEL045C should utilize these essential resources:

  • Yeast-specific databases:

    • Saccharomyces Genome Database (SGD): Comprehensive genetic and phenotypic data

    • SPELL: Expression pattern analysis across thousands of conditions

    • YeastGFP: Subcellular localization data

    • FungiDB: Comparative genomics across fungal species

  • Functional genomics resources:

    • TheCellMap.org: Genetic interaction profiles

    • BioGRID: Physical and genetic interaction data

    • YeastNet: Functional gene networks

    • YMDB (Yeast Metabolome Database): Metabolomic data

  • Structural and sequence analysis tools:

    • PDB and AlphaFold DB: Protein structure repositories

    • UCSF Chimera: Structure visualization and analysis

    • ConSurf: Evolutionary conservation mapping

    • InterProScan: Functional domain prediction

  • Strain and plasmid repositories:

    • Yeast Genetic Stock Center: Validated strain collections

    • AddGene: Plasmid repository for expression constructs

    • Yeast Deletion Collection: Systematic gene deletion strains

    • Yeast GFP Collection: Fluorescently tagged proteins

These resources provide complementary data types that can be integrated to develop comprehensive hypotheses about YEL045C function, avoiding duplication of existing work and accelerating new discoveries .

How can researchers effectively design experiments to determine if contradictory findings about YEL045C are due to methodological differences? [ADVANCED]

To effectively resolve methodology-based contradictions in YEL045C research:

  • Standardized protocol development strategy:

    • Identify key variables in contradictory studies:

      Experimental FactorDocumentation RequirementsStandardization Approach
      Strain backgroundComplete genotypeUse isogenic strains
      Growth conditionsMedia composition, temperature, growth phaseImplement identical protocols
      Assay parametersReagent sources, equipment settingsCross-validate between labs
      Data analysisSoftware, statistical methodsShare raw data and scripts
  • Sequential variable isolation approach:

    • Systematically test one variable at a time while controlling others

    • Implement factorial experimental designs to detect interaction effects

    • Use positive and negative controls specific to each methodological variation

    • Document all parameters in machine-readable format for computational analysis

  • Cross-laboratory validation framework:

    • Develop detailed standard operating procedures (SOPs)

    • Exchange key reagents (strains, antibodies, plasmids)

    • Implement blinded experimental designs

    • Establish consistent quality control metrics

  • Meta-analytical approach:

    • Formally assess effect sizes across studies

    • Implement Bayesian analyses to quantify evidence for competing hypotheses

    • Identify moderator variables that explain heterogeneity

    • Develop integrative models that account for methodological variations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.