Recombinant Saccharomyces cerevisiae Uncharacterized protein YER181C, mitochondrial (YER181C)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The YER181C gene is located on chromosome VII of S. cerevisiae and encodes a mitochondrial protein of 107 amino acids (aa) with a predicted molecular weight of 12.1 kDa (Table 1) . Limited functional annotations exist, but its mitochondrial localization and uncharacterized status suggest potential roles in organelle-specific processes.

PropertyValue
Gene LocusYER181C
ChromosomeVII
Protein Length107 aa
Molecular Weight12.1 kDa
Subcellular LocalizationMitochondrial
Recombinant HostE. coli (His-tagged)

Table 1: Basic characteristics of YER181C .

Research Gaps and Future Directions

Despite its availability, YER181C remains uncharacterized, with no published studies on its biological function, interacting partners, or enzymatic activity. Key unknowns include:

  1. Mitochondrial Role: Potential involvement in energy metabolism, stress response, or protein quality control (similar to other mitochondrial proteins like TRAP1 or Hsp31 ).

  2. Structural Insights: No crystallographic or cryo-EM data to elucidate its fold or binding sites.

  3. Pathway Involvement: No evidence linking YER181C to glycation repair (unlike Hsp31 paralogs ) or mitochondrial translation regulation (unlike TRAP1 ).

Comparative Context with Related Yeast Proteins

While YER181C lacks functional data, its mitochondrial localization invites comparison to well-studied S. cerevisiae proteins:

ProteinFunctionKey References
Hsp31Deglycase activity, glycation repair
TRAP1Translation elongation regulation, mitochondrial chaperone
San1Nuclear protein quality control

Table 3: Functional roles of mitochondrial proteins in S. cerevisiae .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
YER181C; Uncharacterized protein YER181C, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YER181C
Target Protein Sequence
MLILLRLSEVCVNFVIIIGIPLLIEASILCIQNILELLLKGIGILKFNRYLHTIILRLFF LSFYMLHFPITLSILAFQLPLNLLTLSQASFHLPRSHMILYQQQECY
Uniprot No.

Target Background

Database Links

STRING: 4932.YER181C

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How should I store and handle recombinant YER181C protein?

Proper storage and handling of recombinant YER181C is essential for maintaining protein integrity:

  • Storage Temperature: Store at -20°C/-80°C upon receipt

  • Aliquoting: Necessary for multiple use to avoid repeated freeze-thaw cycles

  • Reconstitution Protocol:

    • Briefly centrifuge vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

  • Working Aliquots: Store at 4°C for up to one week

  • Storage Buffer: Typically provided in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Stability Note: Repeated freezing and thawing is not recommended

What applications is recombinant YER181C typically used for?

While YER181C is uncharacterized, the recombinant protein has several research applications:

  • SDS-PAGE Analysis: Primary application for protein characterization

  • Antibody Production: Generation of specific antibodies for detection studies

  • Protein-Protein Interaction Studies: Identifying binding partners using pull-down assays

  • Structural Studies: Investigating protein folding and structural characteristics

  • Functional Screening: Testing for enzymatic activities or biochemical functions

  • Mitochondrial Import Studies: Analyzing protein import mechanisms into mitochondria

What purification strategies give the highest purity for recombinant YER181C?

Affinity chromatography using the His-tag is the primary purification method for recombinant YER181C. A comprehensive purification strategy includes:

  • Affinity Chromatography:

    • Nickel-NTA resin for His-tagged protein capture

    • Imidazole gradient elution to minimize non-specific binding

  • Additional Purification Steps:

    • Size exclusion chromatography to separate aggregates and improve homogeneity

    • Ion exchange chromatography if higher purity is required

  • Quality Control:

    • SDS-PAGE analysis confirms purity >90%

    • Western blot verification of identity

    • Mass spectrometry confirmation of molecular weight and sequence integrity

How can I optimize yield when expressing recombinant YER181C in E. coli?

Optimization of YER181C expression requires systematic adjustment of multiple parameters:

ParameterOptimization StrategyImpact
TemperatureTest 16°C, 25°C, and 37°CLower temperatures (16-25°C) often improve folding of mitochondrial proteins
Induction TimeVary from 3-24 hoursLonger induction at lower temperatures can increase yield
IPTG ConcentrationTest 0.1-1.0 mM rangeLower concentrations may improve solubility
Media CompositionCompare LB, TB, and auto-inductionTB and auto-induction often increase biomass and yield
Host StrainTest BL21(DE3), Rosetta, SHuffleStrains with additional tRNAs or chaperones can improve expression
Co-expressionAdd chaperones (GroEL/ES, DnaK)Mitochondrial proteins often benefit from chaperone assistance

Researchers report highest yields using BL21(DE3) strain with induction at OD600 0.6-0.8 using 0.5 mM IPTG, followed by overnight expression at 18°C .

What bioinformatic approaches should I use to predict potential functions of YER181C?

A comprehensive bioinformatic analysis workflow for YER181C includes:

  • Sequence Homology Analysis:

    • BLAST against protein databases to identify similar proteins

    • PSI-BLAST for detecting remote homologs

    • Multiple sequence alignment to identify conserved residues

  • Structural Prediction:

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • Secondary structure prediction using PSIPRED

    • Identification of potential transmembrane domains using TMHMM

  • Functional Prediction:

    • InterProScan for domain and functional site prediction

    • PFAM for protein family assignment

    • GO term prediction based on sequence and structural features

  • Mitochondrial Targeting Analysis:

    • TargetP and MitoProt for mitochondrial targeting sequence prediction

    • Mitochondrial protein import pathway prediction

    • Submitochondrial localization prediction

What experimental approaches are recommended for determining the function of uncharacterized mitochondrial proteins like YER181C?

A multi-faceted experimental approach provides the best chance of determining function:

  • Genetic Analysis:

    • Generate knockout/deletion strains using techniques like the short flanking homology (SFH) method

    • Perform phenotypic analysis under various growth conditions

    • Test sensitivity to mitochondrial stressors

    • Conduct synthetic genetic array (SGA) analysis to identify genetic interactions

  • Localization Studies:

    • Confirm mitochondrial localization using fluorescent protein tagging

    • Determine submitochondrial compartment using protease protection assays

    • Assess impact of targeting sequence mutations on localization

  • Protein Interaction Studies:

    • Yeast two-hybrid (Y2H) screening to identify interaction partners

    • Co-immunoprecipitation or pull-down assays to confirm interactions

    • Proximity labeling to identify neighboring proteins in mitochondria

  • Functional Assays:

    • Measure mitochondrial function parameters (respiration, membrane potential)

    • Assess metabolic alterations using mass spectrometry

    • Monitor mitochondrial dynamics and morphology

How should I design gene deletion experiments to study YER181C function?

Designing gene deletion experiments for YER181C requires careful planning:

  • Deletion Strategy:

    • Use the short flanking homology (SFH) method with KanMX4 selection marker

    • Design primers with 40-50 bp homology to regions flanking YER181C

  • Transformation Protocol:

    • Transform yeast using the lithium acetate method described by Gietz and Woods (2002)

    • Select transformants on YPD with 200 mg/L G418 (geneticin)

  • Verification Approach:

    • Confirm deletion by PCR using primers outside the integration site

    • Verify absence of YER181C transcript by RT-PCR

    • Confirm protein absence by western blot if antibodies are available

  • Control Strains:

    • Include wild-type parent strain as control

    • Consider creating strains with deletion of functionally related genes for comparison

  • Phenotypic Analysis:

    • Test growth in different carbon sources and nitrogen conditions

    • Evaluate mitochondrial function using respiratory growth measurements

    • Assess response to mitochondrial stressors

    • Analyze growth using continuous culture techniques in a bioreactor

How can I investigate the potential role of YER181C in mitochondrial function using genome-scale metabolic models?

Genome-scale metabolic models (GEMs) provide powerful tools for investigating mitochondrial protein function:

  • Model Selection:

    • Use Yeast8.5.0 GEM which contains 2742 metabolites, 4058 reactions, and 1150 genes

    • This model has been expanded to include more comprehensive mitochondrial metabolism

  • Simulation Approaches:

    • Perform Flux Balance Analysis (FBA) to predict metabolic changes in YER181C deletion strains

    • Use dynamic FBA (dFBA) to model temporal changes in metabolism

    • Implement parsimonious FBA (pFBA) with multiphase multiobjective optimization

  • Condition-Specific Modeling:

    • Model growth under different carbon sources and nitrogen limitations

    • Simulate aerobic vs. anaerobic conditions to assess respiratory chain involvement

    • Model response to mitochondrial stress conditions

  • Integration with Experimental Data:

    • Constrain flux boundaries using experimental measurements

    • Validate model predictions with growth phenotypes and metabolomics data

    • Refine models iteratively based on experimental outcomes

What approaches can I use to investigate protein-protein interactions involving YER181C?

Multiple complementary techniques can reveal YER181C protein interaction networks:

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Use YER181C as bait to screen for interacting proteins

    • Test specific interactions with known mitochondrial proteins

    • Conduct domain-specific Y2H to map interaction regions

  • Affinity Purification Coupled to Mass Spectrometry:

    • Perform pull-down experiments using His-tagged YER181C

    • Analyze co-purifying proteins by LC-MS/MS

    • Implement SILAC or TMT labeling for quantitative comparison

  • In Vitro Binding Assays:

    • Use Microscale Thermophoresis (MST) to measure binding affinities

    • Determine apparent dissociation constants (Kd) for potential interactions

    • Analysis of Hill coefficients to detect cooperative binding

  • Structural Analysis of Complexes:

    • Perform crosslinking mass spectrometry to identify interaction interfaces

    • Use cryo-EM for structural characterization of protein complexes

    • Deploy hydrogen-deuterium exchange mass spectrometry to map binding sites

Recent methodological advances using MST have achieved high sensitivity in detecting protein interactions with Kd values in the 0.16-0.23 μM range for mitochondrial protein complexes, making this a valuable approach for YER181C studies.

How can I analyze transcriptomic data to understand the impact of YER181C deletion on cellular pathways?

Analysis of transcriptomic data from YER181C deletion strains requires a systematic approach:

  • Experimental Design Considerations:

    • Compare gene expression between wild-type and YER181C deletion strains

    • Include multiple growth conditions (carbon sources, stress conditions)

    • Test nitrogen-limited conditions as these often reveal mitochondrial phenotypes

  • RNA-Seq Analysis Pipeline:

    • Quality control and trimming of raw reads

    • Alignment to S. cerevisiae reference genome

    • Quantification of gene expression levels

  • Differential Expression Analysis:

    • Identify significantly altered genes using DESeq2 or edgeR

    • Apply appropriate statistical thresholds (adjusted p-value <0.05)

    • Visualize expression changes using volcano plots and heatmaps

  • Functional Enrichment Analysis:

    • Identify enriched GO terms and pathways

    • Perform gene set enrichment analysis (GSEA)

    • Map changes to specific mitochondrial processes

  • Integration with Other Data Types:

    • Correlate expression changes with metabolomic alterations

    • Identify relationships with protein-protein interaction networks

    • Compare with phenotypic data to establish mechanism-phenotype relationships

How can advanced microscopy techniques contribute to understanding YER181C function?

Advanced microscopy approaches offer unique insights into mitochondrial protein function:

  • Super-Resolution Microscopy:

    • STED or PALM imaging to visualize submitochondrial localization

    • Track protein dynamics and distribution within mitochondria

    • Quantify colocalization with known mitochondrial compartment markers

  • Live-Cell Imaging:

    • Monitor dynamics of fluorescently tagged YER181C

    • Assess protein mobility using FRAP (Fluorescence Recovery After Photobleaching)

    • Observe responses to mitochondrial stress in real-time

  • Multi-color Imaging:

    • Simultaneous visualization of YER181C with interaction partners

    • Co-imaging with mitochondrial structural markers

    • Correlation with functional indicators (membrane potential, ROS)

  • Correlative Light and Electron Microscopy (CLEM):

    • Connect fluorescence observations with ultrastructural details

    • Precisely localize YER181C within mitochondrial subcompartments

    • Visualize effects of YER181C deletion on mitochondrial ultrastructure

What can we learn from studying the role of YER181C in different S. cerevisiae strains?

Comparative analysis across S. cerevisiae strains offers valuable insights:

  • Strain-Specific Variations:

    • Commercial strains like Lallemand 71B, Lallemand EC1118, Uvaferm, Lalvin R2, Lalvin ICV Opale, and Vitivelure Elixir have distinct metabolic and genetic characteristics

    • Analysis of YER181C function across these strains can reveal condition-specific roles

  • Growth Condition Responses:

    • Different strains exhibit varied responses to nitrogen limitation

    • YER181C may show strain-specific importance under enological conditions

    • Growth parameters can be analyzed using the Gompertz equation to quantify differences

  • Metabolic Modeling Approaches:

    • Strain-specific genome-scale metabolic models can predict metabolic impacts

    • Dynamic FBA frameworks allow simulation of strain-specific temporal responses

    • Integration of experimental data improves prediction accuracy

  • Technological Characterization:

    • DNA-microarray technology can analyze strain-specific expression profiles

    • Combining genotypic and technological characterization reveals functional relevance

How might studies of YER181C contribute to understanding mitochondrial disease mechanisms?

Research on uncharacterized mitochondrial proteins like YER181C has important implications for human disease:

  • Conservation Analysis:

    • Identification of potential human homologs through bioinformatic approaches

    • Assessment of functional conservation between yeast and human mitochondrial proteins

    • Evaluation of structural similarities that might indicate shared functions

  • Disease Modeling:

    • Using yeast as a model system for mitochondrial diseases like MELAS and LHON-Plus

    • Implementing YER181C mutations that mimic disease-associated variants

    • Testing therapeutic approaches in yeast before moving to higher organisms

  • Therapeutic Target Identification:

    • Uncharacterized mitochondrial proteins may represent novel drug targets

    • Understanding yeast mitochondrial protein networks guides human studies

    • Pharmacological strategies for reprogramming mitochondrial metabolism can be tested

  • Translational Research Applications:

    • Development of recombinant yeast expressing modified versions of YER181C

    • Engineering yeast for targeted delivery of therapeutic molecules

    • Using yeast-based screening systems for drug discovery

Current clinical advances include basket phase I clinical trials for ultra-rare mitochondrial diseases, highlighting the translational potential of basic research on mitochondrial proteins.

What experimental workflow would you recommend for a new researcher beginning to study YER181C?

For researchers new to studying YER181C, I recommend this systematic workflow:

  • Initial Characterization (0-3 months):

    • Bioinformatic analysis of sequence and predicted structure

    • Confirmation of mitochondrial localization

    • Generation of deletion strain and initial phenotypic characterization

  • Functional Investigation (3-9 months):

    • Detailed phenotypic analysis under various conditions

    • Transcriptomic and proteomic comparison of deletion strain

    • Identification of genetic and physical interaction partners

  • Mechanistic Studies (9-18 months):

    • Detailed biochemical characterization of purified protein

    • Structure determination if possible

    • Testing of specific hypotheses generated from earlier steps

  • Integration and Application (18-24 months):

    • Development of a functional model

    • Exploration of relevance to mitochondrial biology

    • Investigation of potential biotechnological applications

This timeline can be adjusted based on available resources and specific research priorities.

What are the current limitations in studying uncharacterized proteins like YER181C, and how might they be overcome?

Current limitations and potential solutions include:

LimitationSolution Approach
Functional redundancy masking phenotypesCreate multiple gene deletions; use synthetic genetic arrays
Limited conservation for homology predictionEmploy sensitive structure prediction tools like AlphaFold
Challenges in protein expression/purificationTest multiple tags and expression systems; optimize buffer conditions
Difficulty detecting weak/transient interactionsUse proximity labeling techniques; apply crosslinking methods
Limited availability of specific antibodiesGenerate custom antibodies; use epitope tagging strategies
Integration of multiple data typesApply machine learning for data integration; develop unified databases

Emerging technologies like AlphaFold have revolutionized structural prediction for uncharacterized proteins, while CRISPR-based methods are enhancing our ability to study gene function with unprecedented precision .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.