Recombinant Saccharomyces cerevisiae Uncharacterized protein YFR035C (YFR035C)

Shipped with Ice Packs
In Stock

Description

Introduction to YFR035C

YFR035C is classified as a putative protein of unknown function in Saccharomyces cerevisiae . The protein is of particular interest because deletion mutants exhibit a synthetic phenotype with alpha-synuclein , a protein associated with Parkinson's disease and other neurodegenerative disorders in humans. This synthetic interaction suggests YFR035C may have roles in cellular processes relevant to protein folding, quality control, or proteostasis mechanisms.

S. cerevisiae, commonly known as baker's yeast or brewer's yeast, has been instrumental in biotechnology applications including winemaking, baking, and brewing since ancient times . As one of the most intensively studied eukaryotic model organisms, S. cerevisiae has contributed significantly to our understanding of fundamental cellular processes, with many proteins important in human biology first discovered through studying their yeast homologs . Approximately 31% of yeast genes have homologs in the human genome, highlighting the evolutionary conservation of basic cellular mechanisms .

Genomic Location and Nomenclature

The systematic name "YFR035C" follows the established nomenclature for S. cerevisiae genes . In this naming convention:

ComponentMeaning
YIndicates a yeast gene
FChromosome 6 (A=1, B=2, etc.)
RRight arm of the chromosome
03535th open reading frame on that arm from the centromere
CCoding sequence on the Crick (antisense) strand

This systematic naming approach provides immediate information about the genomic location and orientation of YFR035C, similar to other yeast genes such as YBR134C (SUP45) and YDL102W (POL3) .

Genomic Context within S. cerevisiae

The S. cerevisiae genome was the first eukaryotic genome to be completely sequenced, with the sequence released to the public domain on April 24, 1996 . The genome consists of approximately 12,156,677 base pairs organized into 16 chromosomes and contains about 6,275 genes, although only about 5,800 of these are believed to be functional . YFR035C represents one of these genes within this compact genome. The regular updates and annotations maintained at the Saccharomyces Genome Database provide a valuable resource for researchers studying yeast genes including YFR035C.

Functional Annotation

YFR035C is designated as a putative protein of unknown function . According to the BioGRID database (ID: 31192), the protein does not have any annotated GO Process, GO Function, or GO Component terms , highlighting significant gaps in our understanding of its biological role. This lack of functional annotation places YFR035C among the remaining uncharacterized genes in the yeast genome that continue to challenge our complete understanding of this model organism.

Phenotypic Analysis

The most significant known characteristic of YFR035C is that deletion mutants exhibit a synthetic phenotype with alpha-synuclein . This suggests that while the protein may not be essential under standard laboratory conditions, it becomes important in the context of alpha-synuclein expression, which is associated with cellular stress and protein aggregation.

Large-scale phenotypic analysis approaches, such as those documented in the TRIPLES database (TRansposon-Insertion Phenotypes, Localization and Expression in Saccharomyces), provide valuable resources for understanding gene function in S. cerevisiae. The TRIPLES database contains over 120,000 data points from phenotypic analyses of haploid yeast strains with transposon-mutagenized genes tested under 21 different conditions . While specific phenotypic data for YFR035C from TRIPLES is not detailed in the search results, such resources represent important tools for characterizing uncharacterized proteins.

Protein Interactions

According to BioGRID, YFR035C has 54 reported interactors involved in 59 interactions . These interaction data provide a foundation for understanding the functional context of YFR035C within the cell. Protein-protein interactions often indicate involvement in common biological processes or pathways and can be critical for inferring the function of uncharacterized proteins.

Interaction DataCount
Interactors54
Interactions59

This network of interactions suggests that YFR035C may participate in multiple cellular processes or complexes, potentially providing clues to its functional role within the cell.

Network Analysis Approaches

Network analysis of YFR035C's interactions could potentially reveal functional modules or biological processes associated with this protein. By examining the functional annotations of interacting partners, it may be possible to infer potential roles for YFR035C through the principle of guilt by association, where proteins involved in similar processes tend to interact.

Gene Expression Analysis

Gene expression analysis provides insights into when and where genes are active within an organism. The TRIPLES database contains gene expression data for 7,581 S. cerevisiae clones, including 7,539 induced during vegetative growth . Similar approaches could be applied to study the expression patterns of YFR035C under various conditions, potentially providing clues to its function.

Protein Localization Studies

Protein localization studies can reveal important functional information. The TRIPLES database includes protein localization data for 6,970 clones, with 1,050 showing discrete subcellular localizations . These studies typically use epitope-tagged proteins and indirect immunofluorescence to determine subcellular localization patterns.

Determining the subcellular localization of YFR035C would provide valuable clues about its potential function. The subcellular localization of a protein often correlates with its functional role, such as nuclear localization for transcription factors or mitochondrial localization for proteins involved in respiration.

Transposon Mutagenesis and Phenotypic Screening

Transposon mutagenesis represents a powerful approach for studying gene function in S. cerevisiae. The TRIPLES database documents extensive data from transposon-mutagenized yeast strains , as summarized in the table below:

Data TypeTotal ClonesNotable Observations
mTn insertion point data7,7492,347 affected genes
NORF data1,795-
Gene expression data7,5817,539 induced during vegetative growth
Phenotypic data6,6113,138 strains with mutant phenotypes
Protein localization data6,9701,050 subcellular localizations

These approaches provide systematic ways to analyze gene function through the creation and characterization of targeted mutations and could be applied specifically to YFR035C to generate detailed functional insights.

cerevisiae as a Recombinant Protein Production Host

S. cerevisiae is widely used as a host for recombinant protein production due to several advantages:

  1. Similarity of protein secretion pathways to higher eukaryotes

  2. Capacity for eukaryotic post-translational modifications

  3. Robust growth on simple media in large-scale bioreactors

  4. Well-established genetic manipulation techniques

These characteristics make S. cerevisiae a preferred host for producing secretory recombinant proteins, from industrial enzymes to therapeutic proteins .

Strategies for Recombinant YFR035C Expression

Several strategies could be employed for the recombinant expression of YFR035C in S. cerevisiae or other host systems. For efficient expression in yeast, integration of expression cassettes into specific genomic locations can enhance stability and expression levels.

Particularly effective strategies include integration into non-coding genomic positions such as the non-transcribed spacer (NTS) of ribosomal DNA (rDNA) units and terminal repeat delta sites of Ty retrotransposon in S. cerevisiae . Multiple integrations are often preferred over single insertion sites to achieve higher expression levels, especially for secretory proteins .

Functional Characterization Approaches

Given the limited annotation of YFR035C, comprehensive functional characterization represents a primary direction for future research. Potential approaches include:

  1. Systematic phenotypic analysis under diverse environmental conditions

  2. Investigation of the molecular basis of the synthetic interaction with alpha-synuclein

  3. Detailed analysis of protein-protein interactions using techniques such as affinity purification coupled with mass spectrometry

  4. Comparative genomics to identify evolutionary conservation patterns

Synthetic Biology Applications

Recent developments in synthetic biology approaches have enhanced the capacity to construct yeast cell factories with improved protein folding, secretion, and post-translational modification functions . These advances could be applied to the production and study of recombinant YFR035C.

The development of novel expression systems in various yeast species continues to expand the toolkit available for recombinant protein production . Once the function of YFR035C is better understood, these systems could potentially be utilized to produce the protein for structural studies, functional assays, or biotechnological applications.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. For specific delivery times, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
YFR035C; Uncharacterized protein YFR035C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YFR035C
Target Protein Sequence
MSASDKTKLCNKGMSRTSRTTTFVITPAFRERDDEGANSLCKAFLNTFSNLKSGMFKCLL GVGAVGTFISTFPQFFLLPCLLCVRCVCVCLCASISYAASAIFSFSIFFFFCLA
Uniprot No.

Target Background

Database Links

KEGG: sce:YFR035C

STRING: 4932.YFR035C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YFR035C and why is it significant in yeast research?

YFR035C is an uncharacterized open reading frame (ORF) in the Saccharomyces cerevisiae genome located on chromosome VI. Despite being identified during genome sequencing projects, its precise function remains largely unknown, making it a target for fundamental research into protein function discovery. The significance of studying YFR035C lies in understanding the complete functional landscape of the yeast proteome, as S. cerevisiae serves as an important eukaryotic model organism. Characterizing previously unknown proteins contributes to our understanding of cellular processes and potentially reveals new biological pathways that may be conserved across eukaryotes.

What are the known genetic interactions of YFR035C?

YFR035C has been identified to have a significant negative genetic interaction with ERG3, as demonstrated in high-throughput genetic interaction studies. This interaction has an SGA (Synthetic Genetic Array) score of -0.1794 with a P-value of 0.0002998, indicating a reliable negative genetic relationship . Negative genetic interactions suggest that mutations or deletions in both genes result in a more severe fitness defect than would be expected from the individual mutations alone. The interaction between YFR035C and ERG3 specifically affects colony size phenotype (APO:0000063), suggesting a potential functional relationship between these genes in cellular processes related to growth or division .

What approaches should researchers use to predict the function of YFR035C?

Researchers should implement multiple complementary approaches to predict YFR035C function:

  • Computational prediction methods:

    • Sequence homology analysis across species

    • Protein structure prediction and domain identification

    • Gene co-expression network analysis

    • Phylogenetic profiling

  • Experimental validation approaches:

    • Systematic genetic interaction mapping

    • Protein localization studies

    • Expression profiling under various conditions

    • Phenotypic analysis of deletion strains

  • Integration of data types:

    • Combining genetic interaction data with protein-protein interaction networks

    • Correlating expression profiles with cellular phenotypes

    • Incorporating data from related model organisms

For computational approaches, researchers should employ machine learning algorithms trained on known protein functions to predict potential functions of YFR035C based on sequence features, predicted structural elements, and interaction partners such as ERG3 .

What crossing designs are most effective for studying YFR035C in synthetic recombinant populations?

When studying YFR035C in synthetic recombinant populations, researchers should consider two main crossing design approaches:

S-type crossing design: This approach involves careful pairing of haploid strains of opposite mating types, followed by controlled mating, sporulation, and isolation of meiotic products. S-type designs provide better representation of founder genotypes and more controlled recombination . For YFR035C studies, this approach is advantageous when precise control over genetic background is required.

K-type crossing design: This approach involves less controlled mass mating of mixed populations. While more straightforward to implement, K-type designs may result in uneven representation of founder genotypes .

For optimal experimental design when studying YFR035C:

  • Begin with validated haploid strains containing appropriate markers

  • Implement paired crossing with verified opposite mating types

  • Isolate successful diploid colonies and confirm proper marker segregation

  • Conduct regular cycles of sporulation, spore isolation, and mating (minimum 12 cycles recommended)

  • Sequence populations at multiple timepoints (initial, cycle 6, cycle 12) to track genetic changes

This methodical approach ensures proper representation of YFR035C alleles in the recombinant population and allows for robust analysis of genetic interactions.

How should growth assays be designed to evaluate YFR035C phenotypes?

To properly evaluate phenotypes associated with YFR035C, researchers should implement standardized growth assays with the following methodology:

  • Sample preparation:

    • Maintain two biological replicates of each strain/population

    • Grow overnight cultures in YPD media (~24 hours at 30°C with 200 rpm shaking)

    • Standardize cultures to OD600 of 0.05 (acceptable range: 0.042-0.061)

    • Aliquot 200μL of standardized culture to 96-well plates with two technical replicates per biological replicate

    • Arrange technical replicates strategically to control for edge effects

  • Data collection parameters:

    • Use a microplate reader (e.g., Tecan Spark Multimode)

    • Measure absorbance at 600 nm every 30 minutes

    • Maintain temperature at 30°C

    • Continue measurements for 48 hours

    • Avoid plate agitation during measurements to ensure consistency

  • Data analysis:

    • Use specialized growth curve analysis software (e.g., "Growthcurver" R package)

    • Calculate growth rates, lag times, and maximum cell densities

    • Compare YFR035C mutants with wild-type controls and other relevant strains

    • Perform statistical analyses to determine significant differences

This standardized approach enables reliable comparison between wild-type and YFR035C mutant strains, as well as strains with mutations in potential interaction partners like ERG3 .

What genome sequencing and SNP identification methods are recommended for YFR035C studies?

For effective genome sequencing and SNP identification in YFR035C studies, researchers should implement the following methodology:

  • Sample preparation for sequencing:

    • Validate strains through drug resistance marker verification and barcode sequencing

    • Isolate single colonies to ensure genetic homogeneity

    • Grow overnight cultures in appropriate media

    • Perform genomic DNA extraction using standardized protocols

  • Sequencing approach:

    • Sequence populations at multiple timepoints to track genetic changes

    • For recombinant populations: sequence at initial stage (cycle 0), mid-experiment (cycle 6), and end-point (cycle 12)

    • Also sequence all haploid founder strains to establish baseline genotypes

    • Use next-generation sequencing platforms with sufficient coverage (30-50x recommended)

  • SNP identification pipeline:

    • Align reads to reference genome using standard tools (BWA, Bowtie2)

    • Call variants using multiple algorithms (GATK, FreeBayes, SAMtools)

    • Filter SNPs based on quality metrics, depth, and allele frequency

    • Validate novel SNPs in YFR035C through secondary methods (Sanger sequencing)

    • Track allele frequency changes across timepoints to identify selection signatures

This comprehensive approach ensures accurate identification of genetic variants in YFR035C and enables tracking of genotype frequencies in experimental populations over time .

How can researchers interpret the negative genetic interaction between YFR035C and ERG3?

The negative genetic interaction between YFR035C and ERG3 (SGA score = -0.1794, P-value = 0.0002998) provides valuable insights into potential functional relationships . To properly interpret this interaction:

  • Significance interpretation:

    • The interaction exceeds the significance threshold (SGA score < -0.12 for negative interactions)

    • The low p-value (0.0002998) indicates high statistical confidence

    • The phenotype affected (colony size) suggests growth-related functional connections

  • Biological context:

    • ERG3 encodes C-5 sterol desaturase, an enzyme involved in ergosterol biosynthesis

    • Negative genetic interactions often indicate genes functioning in parallel pathways or compensatory processes

    • The interaction suggests YFR035C may be involved in membrane-related processes, stress response, or alternative sterol metabolism pathways

  • Research implications:

    • Further investigation should focus on membrane integrity assays

    • Lipid profiling in YFR035C mutants could reveal altered sterol composition

    • Stress response experiments may uncover conditional phenotypes

    • Localization studies should determine if YFR035C protein associates with membranes or endoplasmic reticulum

This interpretation framework helps researchers develop targeted hypotheses about YFR035C function based on its genetic relationship with the well-characterized ERG3 gene .

What synthetic genetic array (SGA) approaches are most effective for studying YFR035C interactions?

For comprehensive analysis of YFR035C genetic interactions, researchers should implement the following SGA approaches:

  • SGA screening methodology:

    • Create query strain with YFR035C deletion marked with selectable marker

    • Cross with genome-wide deletion or hypomorphic allele collection

    • Select double mutants using appropriate markers

    • Quantify colony size using automated image analysis

    • Calculate genetic interaction scores by comparing observed vs. expected growth

  • Key parameters for optimal results:

    • Consider SGA scores significant if below -0.12 for negative interactions

    • Ensure p-values < 0.05 for statistical confidence

    • Implement at least 4 biological replicates per cross

    • Include wild-type controls on each plate to normalize growth measures

    • Use standardized growth conditions (30°C, YPD media) unless testing condition-specific interactions

  • Data analysis and interpretation:

    • Cluster genes based on similarity of genetic interaction profiles

    • Perform GO enrichment analysis on interacting gene sets

    • Compare YFR035C interaction profile with profiles of characterized genes

    • Integrate interaction data with protein-protein interaction networks

This methodology has been successfully implemented in large-scale studies that identified over 550,000 negative genetic interactions in S. cerevisiae, including the YFR035C-ERG3 interaction highlighted in the comprehensive genetic interaction network published in Science .

How can CRISPR/Cas9 genome editing be optimized for functional studies of YFR035C?

CRISPR/Cas9 genome editing provides powerful tools for YFR035C functional studies when optimized with the following methodology:

  • gRNA design considerations:

    • Select target sites with minimal off-target potential using specialized algorithms

    • Design gRNAs targeting both N-terminal and C-terminal regions

    • Create multiple gRNAs to increase editing efficiency

    • Verify gRNA specificity against the entire yeast genome

  • Editing strategies for functional analysis:

    • Precise gene deletion for complete loss-of-function studies

    • Introduction of point mutations to study specific amino acid residues

    • C-terminal tagging for localization and interaction studies

    • Creation of conditional alleles (e.g., degron tags) for temporal control

    • Integration of regulated promoters for expression modulation

  • Efficient transformation protocol:

    • Optimize spheroplast preparation for maximum transformation efficiency

    • Use lithium acetate method with carrier DNA and PEG

    • Implement heat shock parameters: 42°C for 40 minutes

    • Include positive selection markers in donor DNA

    • Verify edits through sequencing and phenotypic assays

  • Validation of edited strains:

    • Confirm edits by Sanger sequencing

    • Verify expression changes through qRT-PCR or Western blotting

    • Check for potential off-target effects using whole-genome sequencing

    • Assess growth rates under various conditions

    • Compare phenotypes with traditional deletion strains

This optimized CRISPR/Cas9 approach enables precise manipulation of YFR035C to investigate its function, interactions, and regulation with greater efficiency than traditional yeast transformation methods.

What high-throughput approaches can be used to characterize YFR035C function under different environmental conditions?

To comprehensively characterize YFR035C function across environmental conditions, researchers should implement these high-throughput approaches:

  • Environmental fitness profiling:

    • Culture YFR035C deletion strains in parallel with wild-type controls

    • Test growth across hundreds of conditions (varying carbon sources, temperatures, pH, osmolarity, toxins)

    • Implement automated liquid handling and growth monitoring systems

    • Quantify condition-specific fitness defects using competitive growth assays with barcode sequencing

    • Use the data to create environmental sensitivity profiles

  • Multi-omics approaches:

    • Transcriptomics: RNA-seq to identify genes differentially expressed in YFR035C mutants

    • Proteomics: Mass spectrometry to quantify protein abundance changes

    • Metabolomics: Identify metabolite alterations in YFR035C deletion strains

    • Lipidomics: Especially relevant given the YFR035C-ERG3 interaction

    • Integrate data types to build comprehensive models of YFR035C function

  • High-content microscopy:

    • Create fluorescently tagged YFR035C to track localization

    • Monitor localization changes under different stresses

    • Perform time-lapse imaging to detect dynamic responses

    • Quantify morphological phenotypes using automated image analysis

    • Correlate localization patterns with environmental conditions

  • Synthetic genetic array under varied conditions:

    • Perform parallel SGA screens under different environmental conditions

    • Identify condition-specific genetic interactions

    • Create environmental genetic interaction networks

    • Compare condition-specific networks to identify functional modules

This multi-faceted approach enables researchers to build a comprehensive understanding of YFR035C function across environmental contexts and provides insight into its role in cellular adaptation to changing conditions.

How should researchers approach comparative genomics to understand YFR035C conservation and evolution?

To effectively investigate YFR035C conservation and evolution through comparative genomics, researchers should implement this methodological framework:

  • Sequence conservation analysis:

    • Identify potential orthologs across fungal species using reciprocal BLAST searches

    • Align sequences using progressive alignment algorithms (e.g., MUSCLE, MAFFT)

    • Calculate sequence conservation scores across alignment positions

    • Identify conserved domains or motifs that may suggest function

    • Create conservation heat maps highlighting regions under selective pressure

  • Phylogenetic analysis:

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Map gene loss/duplication events across evolutionary history

    • Compare evolutionary rates with functionally related genes (e.g., ERG3)

    • Identify lineage-specific adaptations in YFR035C sequence

    • Correlate evolutionary patterns with species' ecological niches

  • Synteny analysis:

    • Examine conservation of chromosomal context around YFR035C

    • Identify consistently co-located genes across species

    • Map genomic rearrangements affecting YFR035C neighborhood

    • Correlate synteny patterns with gene expression regulation

  • Selection analysis:

    • Calculate dN/dS ratios to detect selection signatures

    • Implement site-specific selection detection methods

    • Compare selection patterns across fungal lineages

    • Identify regions under purifying vs. positive selection

    • Correlate selection patterns with predicted protein structure

This comprehensive comparative genomics approach can reveal evolutionary constraints on YFR035C, suggest functional importance of specific regions, and potentially identify species-specific adaptations that provide clues to its biological role.

What are the common challenges in generating YFR035C recombinant strains and how can they be addressed?

Researchers frequently encounter several challenges when generating YFR035C recombinant strains. These challenges and their solutions include:

  • Low transformation efficiency:

    • Solution: Optimize spheroplast preparation by standardizing cell density (OD600 0.8-1.0) and zymolyase treatment time

    • Solution: Use freshly prepared competent cells and high-quality plasmid DNA

    • Solution: Extend recovery time in rich media (YPD) before selection

  • Unexpected phenotypes from genomic position effects:

    • Solution: Use defined integration sites known to have minimal impact on expression

    • Solution: Create multiple independent transformants and compare phenotypes

    • Solution: Verify integration site by PCR and sequencing to confirm proper targeting

  • Mating and sporulation difficulties in recombinant strain creation:

    • Solution: Optimize sporulation conditions (1% potassium acetate media, 72 hours at 30°C)

    • Solution: Use Y-PER reagent followed by zymolyase treatment to disrupt asci

    • Solution: Implement mechanical agitation with silica beads to release and randomize spores

    • Solution: Allow 90 minutes for mating before selection

  • Inconsistent mutant phenotypes:

    • Solution: Standardize growth conditions precisely (OD600 0.05 starting density)

    • Solution: Use multiple biological and technical replicates (minimum 2 of each)

    • Solution: Implement proper controls on each experimental plate

    • Solution: Conduct growth assays in controlled environment (30°C, 48 hours monitoring)

  • Data table: Optimization parameters for YFR035C strain construction:

    ParameterStandard ConditionOptimization RangeKey Indicator of Success
    Sporulation time72 hours48-96 hours>70% tetrad formation
    Mating duration90 minutes60-120 minutes>50% diploid recovery
    Y-PER treatment30 minutes20-40 minutes>80% vegetative cell death
    Zymolyase concentration1%0.5-2%Clear ascus wall disruption
    Silica bead agitation3 minutes2-5 minutesSingle spore separation
    Selection pressureNTC/hyg/G418Varied combinationsClear colony formation

Following these troubleshooting approaches and optimization parameters significantly improves success rates in generating functional YFR035C recombinant strains for experimental studies .

How can researchers validate their findings about YFR035C function?

  • Independent experimental approaches:

    • Confirm genetic interaction findings using multiple methods (SGA, manual crosses, tetrad analysis)

    • Validate high-throughput results with targeted experiments

    • Use both deletion and point mutation approaches to distinguish between complete and partial loss of function

    • Complement findings with orthogonal technologies (e.g., proteomics and transcriptomics)

  • Statistical validation:

    • Ensure adequate statistical power through proper experimental design

    • Apply appropriate statistical tests based on data distribution

    • Implement multiple test corrections for high-throughput data

    • Set significance thresholds appropriate for the experimental approach (e.g., SGA score < -0.12 for negative interactions)

  • Genetic complementation:

    • Rescue phenotypes by reintroducing wild-type YFR035C

    • Test domain-specific function through partial complementation

    • Examine cross-species complementation with potential orthologs

    • Quantify the degree of phenotypic rescue under various conditions

  • Biological replication:

    • Reproduce key findings in different strain backgrounds

    • Test for consistency across different experimental conditions

    • Implement both biological and technical replicates

    • Verify results across independent laboratories when possible

By implementing this validation framework, researchers can build confidence in their findings regarding YFR035C function and minimize the risk of reporting artifacts or strain-specific effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.