Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL230C (YGL230C)

Shipped with Ice Packs
In Stock
Cat. No.
BT2448405
Source
in vitro E.coli expression system
Synonyms
YGL230C; Uncharacterized protein YGL230C
Quick Inquiry

Description

General Information

Recombinant Saccharomyces cerevisiae Uncharacterized protein YGL230C (YGL230C) is a protein derived from the yeast Saccharomyces cerevisiae, also known as Baker's yeast . YGL230C is considered an uncharacterized protein, meaning its specific function within the yeast cell is not yet fully understood . Despite being uncharacterized, research indicates its presence and potential roles in various cellular processes .

Characteristics

  • Source Organism: Saccharomyces cerevisiae (strain 204508 / S288c) .

  • Nature: Protein, recombinant .

  • Modification: Unmodified .

  • Applications: May be used in ELISA (EIA) and WB (Western Blot) assays to identify the antigen .

Genomic Context

YGL230C is encoded by the YGL230C gene in Saccharomyces cerevisiae . The Saccharomyces cerevisiae genome has been extensively studied, with the strain S288c serving as the reference genome for the Saccharomyces Genome Database . Whole-genome sequencing efforts have identified single nucleotide polymorphisms (SNPs) and other genetic variations that differentiate various S. cerevisiae strains, which can lead to different phenotypes .

Role in Oral Immunization

Saccharomyces cerevisiae, including recombinant forms, has been explored for its potential in oral immunization . For instance, S. cerevisiae has been engineered to express the capsid protein VP2 of the infectious bursal disease virus (IBDV) to develop an oral vaccine . In such applications, the recombinant protein's expression is often controlled by constitutive promoters like GAPDH .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YGL230C; Uncharacterized protein YGL230C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGL230C
Target Protein Sequence
MGIITLSGNVLHLLKAYPKKGLEEVSQPEPNTANDSSTEYKGKSKDDFQMVEKSNTDERY NFTRTKKWFLLMTSEYYKLMENRLLMFCIIACSFICAIQFLFFIIYWTNIVPRKTQRAIT NLNYDYLTAHLKEQCVPYAKILDQCIL
Uniprot No.
P53074

Target Background

Database Links

KEGG: sce:YGL230C

STRING: 4932.YGL230C

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.