Recombinant Saccharomyces cerevisiae Uncharacterized protein YHR078W (YHR078W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YHR078W; Uncharacterized protein YHR078W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YHR078W
Target Protein Sequence
MEALIVFIVLSVSGAFAYKCSYERLWFKVGSLFDIISTSSKKNVIPLASKMEVGSNEDVS SMGNFINKFYTEYSLPSHKVLQSLRVLFSLAMMTYTVTIEIILWQIKVAGMDKEVTFITT WVWPLTAIMLSFILILFQPFFIIISLLNKFYNDKFDIDRLIIVTCIILSTLIALLSYINI GPFQYTKNILTRLSIGGVTVMASLSGLATVSSLYYNFLVIWHKFRNTPMSDPSFRNINNS NNNSKSLLWTTDAYIEEKIQDYEHNIEQNVQILRSLEEEVGENSTFKAELMEKIAWYQLE LGKLEALLQQSPQVRTFKKAFEVGFIIYCLHKLIITFLKRIPYIIYHSLKYPDDYDYENF SENAASDPLAITIANILDFSFFRFNYQHDLDSLTKQISLFLSISLFLCCLSAVNTTISYV VTLLPIKFQILALFAMQNDDTANVLPEYTNNSSYKGKKRNYSQEQKGISLIKNLVVSELT GVYVLATTLMVRSHLPFEVSQRLKELLGGKFTVPNIVIDSWFDEVYAFACVFTFICIRIA ERKLSTKKVSVE
Uniprot No.

Target Background

Database Links

KEGG: sce:YHR078W

STRING: 4932.YHR078W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YHR078W and why is it classified as an uncharacterized protein?

YHR078W is a protein encoded by the YHR078W gene in Saccharomyces cerevisiae (Baker's yeast, strain ATCC 204508/S288c). It is classified as "uncharacterized" because its precise biological function has not been fully determined through experimental validation . The protein consists of 552 amino acids and is identified in the UniProt database with the accession number P38799 . Uncharacterized proteins like YHR078W are common in genomic databases, representing genes that have been sequenced but whose products have not been functionally annotated through biochemical or genetic methods.

How is recombinant YHR078W typically produced for research purposes?

Recombinant YHR078W is typically produced through heterologous expression systems. The process involves:

  • Gene cloning: The YHR078W coding sequence is amplified from S. cerevisiae genomic DNA and inserted into an appropriate expression vector.

  • Expression host selection: Common hosts include E. coli, insect cells, or yeast expression systems.

  • Protein expression: The recombinant protein is often produced with affinity tags (determined during the production process) to facilitate purification .

  • Purification: Typically involves affinity chromatography, followed by size exclusion or ion exchange chromatography.

  • Quality control: SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity.

The final product is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage .

What are the optimal experimental conditions for studying YHR078W function?

When designing experiments to study YHR078W function, researchers should consider these key parameters:

Storage and Handling:

  • Store purified protein at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • Use Tris-based buffer with 50% glycerol optimized for protein stability

Experimental Conditions:

  • Temperature range: 25-30°C (optimal for yeast proteins)

  • pH range: 6.0-7.5 (typical for cytoplasmic yeast proteins)

  • Salt concentration: 50-150 mM NaCl (to maintain protein solubility)

Experimental Controls:

  • Positive controls: Known membrane proteins with similar structural characteristics

  • Negative controls: Empty vector or unrelated protein expressed under identical conditions

  • Technical replicates: Minimum of three biological and technical replicates for statistical validity

A factorial experimental design approach is recommended to systematically test variables like temperature, pH, and cofactor requirements .

How can I design experiments to determine the subcellular localization of YHR078W?

To determine the subcellular localization of YHR078W, consider these methodological approaches:

Fluorescent Protein Tagging:

  • Generate C-terminal or N-terminal GFP/mCherry fusion constructs with YHR078W

  • Transform into S. cerevisiae

  • Visualize using confocal microscopy

  • Co-localize with known organelle markers

Subcellular Fractionation:

  • Lyse yeast cells under gentle conditions

  • Separate cellular compartments through differential centrifugation

  • Analyze fractions by Western blotting using anti-YHR078W antibodies

  • Compare distribution pattern with known marker proteins

Immunolocalization:

  • Fix yeast cells with formaldehyde

  • Permeabilize cell wall/membrane

  • Incubate with anti-YHR078W primary antibodies

  • Detect using fluorescently labeled secondary antibodies

  • Co-stain with organelle markers

Based on its sequence characteristics with multiple hydrophobic regions, YHR078W likely localizes to membranes, possibly the plasma membrane or endoplasmic reticulum . Design appropriate controls including known proteins from these compartments.

What bioinformatic approaches can predict potential functions of YHR078W?

Advanced bioinformatic analyses can provide insights into the potential functions of uncharacterized proteins like YHR078W:

Sequence-Based Prediction:

  • Homology searches: BLAST against multiple databases to identify distant relatives

  • Motif identification: Search for conserved domains using PROSITE, Pfam, and InterPro

  • Structural prediction: AlphaFold or RoseTTAFold to predict 3D structure

  • Transmembrane topology: TMHMM or Phobius to predict membrane-spanning regions

Genomic Context Analysis:

  • Synteny analysis: Examine gene neighborhood conservation across species

  • Co-expression data: Identify genes with similar expression patterns

  • Genetic interaction networks: Analyze yeast genetic interaction data from SGD

Evolutionary Analysis:

  • Phylogenetic profiling: Identify co-evolving protein families

  • Selective pressure analysis: Calculate dN/dS ratios to identify functional constraints

The presence of predicted transmembrane domains in YHR078W suggests potential roles in membrane transport, signaling, or protein modification similar to other yeast membrane proteins like Erf2, which is involved in protein palmitoylation .

How can I design comprehensive protein-protein interaction studies for YHR078W?

To identify potential interaction partners of YHR078W, consider these methodological approaches:

Yeast Two-Hybrid (Y2H):

  • Generate bait constructs with YHR078W domains (considering membrane topology)

  • Screen against a yeast genomic library or focused subset

  • Validate interactions through secondary screens

  • Challenges: Membrane proteins often perform poorly in Y2H

Affinity Purification-Mass Spectrometry:

  • Express epitope-tagged YHR078W in yeast

  • Optimize solubilization conditions for membrane proteins

  • Purify protein complexes under native conditions

  • Identify interacting partners by LC-MS/MS

  • Validate with reciprocal tagging and co-immunoprecipitation

Proximity Labeling:

  • Fuse YHR078W to BioID or APEX2

  • Express in yeast cells and activate enzyme

  • Purify biotinylated proteins

  • Identify by mass spectrometry

Split-Ubiquitin Membrane Yeast Two-Hybrid:

  • Particularly suitable for membrane proteins like YHR078W

  • Generate N-terminal and C-terminal ubiquitin fusion constructs

  • Screen against membrane protein library

When analyzing data, apply statistical methods to distinguish true interactions from background, typically requiring multiple replicates and appropriate controls .

What knockout/knockdown strategies can effectively analyze YHR078W function?

To determine the functional significance of YHR078W through gene disruption:

Complete Gene Deletion:

  • Generate YHR078W deletion strain using homologous recombination

  • Replace YHR078W with selectable marker

  • Confirm deletion by PCR and sequencing

  • Analyze phenotypes under various growth conditions

Conditional Repression Systems:

  • Place YHR078W under control of regulatable promoter (tetO, GAL1)

  • Monitor phenotypic changes upon repression

  • Allows study of essential genes

CRISPR-Cas9 Editing:

  • Design gRNAs targeting YHR078W

  • Introduce precise mutations in functional domains

  • Create allelic series to identify critical residues

RNA Interference (in non-S. cerevisiae systems):

  • Express YHR078W in species amenable to RNAi

  • Design siRNAs targeting YHR078W

  • Monitor knockdown efficiency and resulting phenotypes

Data analysis should include growth curves, microscopy of cellular morphology, and transcriptomic/proteomic changes upon YHR078W depletion. Based on the protein's structural features, examine membrane-related phenotypes with particular attention .

How can I design experiments to determine if YHR078W has enzymatic activity?

To investigate potential enzymatic functions of YHR078W:

Activity Prediction and Testing:

  • Analyze sequence for catalytic motifs

  • Based on the DHHC-CRD-like motifs in related proteins, test for:

    • Protein acyltransferase activity (similar to Erf2)

    • Lipid modification functions

    • Membrane protein processing

In Vitro Enzymatic Assays:

  • Express and purify recombinant YHR078W

  • Maintain native conformation with appropriate detergents

  • Screen against substrate libraries

  • Monitor product formation through:

    • Radiometric assays

    • Fluorescence-based detection

    • Mass spectrometry

Functional Complementation:

  • Express YHR078W in mutants lacking related enzymatic functions

  • Test for phenotypic rescue

  • Focus on pathways involving membrane protein modifications

Structural Analysis:

  • Perform X-ray crystallography or cryo-EM

  • Identify potential active sites

  • Design site-directed mutagenesis of putative catalytic residues

When analyzing results, statistical methods including multiple hypothesis testing and ANOVA should be employed to establish significance of observed activities .

How should I analyze high-throughput data related to YHR078W expression and function?

When working with large-scale datasets involving YHR078W:

Transcriptomic Data Analysis:

  • Normalize RNA-seq or microarray data using appropriate methods (RPKM, TPM, etc.)

  • Identify conditions altering YHR078W expression

  • Perform gene co-expression network analysis

  • Apply clustering algorithms to identify functionally related genes

Proteomic Data Analysis:

  • Process mass spectrometry data using appropriate software (MaxQuant, Proteome Discoverer)

  • Apply statistical methods to identify significant protein changes

  • Perform pathway enrichment analysis

  • Visualize protein-protein interaction networks

Genetic Interaction Data:

  • Analyze synthetic genetic array (SGA) data

  • Identify genetic interactions of YHR078W

  • Map to biological pathways

Statistical Approaches:

  • Apply multiple hypothesis testing correction

  • Use appropriate statistical tests based on data distribution

  • Implement linear and non-linear regression models for correlation analyses

Table 1: Example Expression Analysis of YHR078W Under Different Conditions

ConditionYHR078W Expression (Fold Change)p-valueCo-expressed Genes
Heat Shock (37°C)2.30.008HSP42, SSA4, HSP104
Osmotic Stress1.10.62-
Nitrogen Starvation3.50.001ATG8, ATG12, PEX14
Stationary Phase2.80.003SNF1, GIS1, MSN2

How can I interpret contradictory results in YHR078W functional studies?

When faced with conflicting data about YHR078W function:

Systematic Analysis of Experimental Variables:

  • Compare methodological differences between studies

  • Evaluate strain backgrounds used

  • Assess protein expression levels and tags

  • Consider environmental conditions and media composition

Meta-analysis Approaches:

  • Compile results from multiple studies

  • Weight findings based on methodological robustness

  • Identify consistent trends across diverse approaches

  • Apply statistical methods for heterogeneous data

Reconciliation Strategies:

  • Design experiments to directly test competing hypotheses

  • Implement orthogonal techniques to validate findings

  • Consider context-dependent functions of YHR078W

  • Examine potential post-translational modifications affecting function

Replication and Validation:

  • Repeat key experiments with standardized protocols

  • Include appropriate positive and negative controls

  • Blind assessment of results when possible

  • Collaborate with other laboratories for independent verification

Given the uncharacterized nature of YHR078W, contradictory results are not uncommon and may reflect its involvement in multiple cellular processes or context-dependent functions .

How can systems biology approaches enhance our understanding of YHR078W?

Systems biology provides powerful frameworks for studying uncharacterized proteins like YHR078W:

Multi-omics Integration:

  • Combine transcriptomic, proteomic, metabolomic, and interactomic data

  • Apply computational methods to identify emergent patterns

  • Generate testable hypotheses about YHR078W function

  • Implement Bayesian networks to model causal relationships

Mathematical Modeling:

  • Develop dynamic models incorporating YHR078W

  • Simulate perturbations to predict functional outcomes

  • Refine models iteratively with experimental data

  • Identify parameter sensitivities indicating critical pathways

Network Analysis:

  • Position YHR078W within global cellular networks

  • Identify network motifs and modules containing YHR078W

  • Predict functional redundancy and compensation mechanisms

  • Apply graph theory algorithms to infer functional relationships

Evolutionary Systems Biology:

  • Compare YHR078W-containing systems across yeast species

  • Identify conserved and divergent network architectures

  • Infer functional constraints from evolutionary patterns

This integrated approach can reveal emergent properties not apparent from individual experiments and position YHR078W within the broader cellular context .

What are the current challenges and limitations in studying uncharacterized proteins like YHR078W?

Researchers face several significant challenges when investigating uncharacterized proteins:

Technical Challenges:

  • Protein expression and purification difficulties

    • Membrane proteins like YHR078W are often difficult to solubilize

    • Maintaining native conformation during purification

    • Obtaining sufficient quantities for structural studies

  • Functional redundancy masking phenotypes

  • Limitations of available antibodies and detection methods

Analytical Challenges:

  • Distinguishing direct from indirect effects

  • Interpreting high-throughput data with high false positive/negative rates

  • Limited annotation of related proteins restricting comparative analyses

  • Difficulty in designing appropriate assays without functional hints

Strategic Approaches to Overcome Limitations:

  • Implement multiple complementary methodologies

  • Design sensitized genetic backgrounds to reveal subtle phenotypes

  • Develop improved computational prediction methods

  • Apply evolutionary approaches to identify conserved features

  • Consider chemical genetic approaches to identify condition-specific functions

The study of YHR078W exemplifies these challenges, requiring innovative experimental designs and analytical methods to gradually build understanding of its biological role .

What are the most promising research directions for fully characterizing YHR078W?

Based on current knowledge and analytical approaches, several directions show particular promise for elucidating YHR078W function:

Structural Biology:

  • Cryo-EM analysis of YHR078W in membrane environments

  • Structure-guided mutagenesis to identify functional domains

  • Computational modeling of protein dynamics and interactions

Comparative Genomics:

  • Cross-species functional complementation

  • Identification of co-evolving gene clusters

  • Analysis of selection pressures across evolutionary lineages

Chemical Biology:

  • Development of small molecule probes targeting YHR078W

  • Chemical genetic screens to identify synthetic interactions

  • Metabolic labeling to track YHR078W-dependent modifications

Specialized Techniques:

  • Single-cell analysis to detect cell-to-cell variability in YHR078W function

  • Super-resolution microscopy to determine precise subcellular localization

  • Synthetic biology approaches to reconstruct minimal systems containing YHR078W

The transmembrane nature and potential involvement in protein modification pathways similar to Erf2 make YHR078W particularly interesting for understanding fundamental aspects of membrane protein biology and cellular signaling .

How can understanding YHR078W contribute to broader knowledge in molecular biology?

The characterization of YHR078W has implications extending beyond a single protein:

Fundamental Knowledge:

  • Expanding understanding of membrane protein function and regulation

  • Uncovering novel cellular pathways and regulatory mechanisms

  • Elucidating principles of protein evolution and functional divergence

  • Contributing to the comprehensive mapping of the yeast proteome

Methodological Advances:

  • Development of improved techniques for membrane protein analysis

  • Refinement of computational prediction methods for uncharacterized proteins

  • Establishment of integrated workflows for functional annotation

Translational Potential:

  • Identification of conserved mechanisms relevant to human disease

  • Discovery of novel enzymatic activities with biotechnological applications

  • Better understanding of eukaryotic cellular organization and regulation

Research on uncharacterized proteins like YHR078W is essential for completing our understanding of cellular systems and frequently leads to unexpected discoveries that transform our knowledge of fundamental biological processes .

What are the key resources for YHR078W research?

Databases:

  • Saccharomyces Genome Database (SGD): Comprehensive genomic and functional information

  • UniProt (Accession: P38799): Protein sequence and annotation

  • BioGRID: Genetic and physical interaction data

  • NCBI Gene: Genomic context and homology information

Reagents and Tools:

  • Available recombinant proteins: ELISA Recombinant YHR078W (50 μg)

  • Yeast deletion collections: Systematic gene deletion strains

  • ORF collections: Tagged expression constructs

Analytical Platforms:

  • Bioinformatics servers for protein analysis

  • Statistical packages for experimental design and data analysis

  • Visualization tools for multi-omics data integration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.