Recombinant Saccharomyces cerevisiae Uncharacterized protein YJL028W (YJL028W)

Shipped with Ice Packs
In Stock

Description

Genetic Context

YJL028W belongs to a subset of S. cerevisiae genes classified as “uncharacterized” due to insufficient experimental evidence. Key genetic features include:

  • Locus: Chromosome X (systematic name: YJL028W).

  • Homologs: Limited to fungal species, suggesting niche-specific evolution .

  • Genomic Neighborhood: No repetitive sequences or telomeric proximity reported, contrasting with other uncharacterized ORFs linked to duplication-prone regions .

Functional Studies

No peer-reviewed studies have investigated YJL028W’s biological role. The protein is part of a broader category of yeast ORFs lacking functional annotation, which constitutes ~5% of the genome . Potential challenges include:

  • Lack of Homologs: Absence of conserved domains across eukaryotes complicates functional inference .

  • Experimental Prioritization: Focus on high-profile genes (e.g., RAD24) may divert resources from uncharacterized ORFs .

Recombinant Production

Commercially available recombinant YJL028W is used primarily for structural or immunological studies. No data exist on its application in:

  • Cancer Vaccines: Unlike other recombinant S. cerevisiae constructs targeting tumor antigens (e.g., CEA, Ras) , YJL028W has no reported therapeutic use.

  • Pathway Interactions: No documented interactions with metabolic or signaling pathways .

Potential Research Avenues

  1. Functional Screening: Yeast two-hybrid or CRISPR-based knockouts to identify interacting partners or phenotypes.

  2. Genomic Context Analysis: Investigate synteny with neighboring ORFs to infer putative roles.

  3. Comparative Genomics: Compare sequence conservation across fungal species to identify conserved motifs.

Challenges

  • Low Priority in Functional Genomics: Uncharacterized ORFs often lack funding or experimental tools .

  • Technical Limitations: Recombinant production in E. coli may not replicate native folding or post-translational modifications .

Table 2: Amino Acid Sequence Segmentation

SegmentSequence
1–30MALWGRSAYRQKTVTSRLTKHRHTSPLNLLNFFIFFSLHLCALFLATAVHYACFACFVLF RHAILLLFYLLARGRASQIQARQKVRCTGATFYRFLIISLSQRAWATKKPI

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
YJL028W; J1267; Uncharacterized protein YJL028W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL028W
Target Protein Sequence
MALWGRSAYRQKTVTSRLTKHRHTSPLNLLNFFIFFSLHLCALFLATAVHYACFACFVLF RHAILLLFYLLARGRASQIQARQKVRCTGATFYRFLIISLSQRAWATKKPI
Uniprot No.

Target Background

Database Links

KEGG: sce:YJL028W

STRING: 4932.YJL028W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the current knowledge status of YJL028W in Saccharomyces cerevisiae?

YJL028W is classified as an uncharacterized protein in the Saccharomyces cerevisiae genome, with limited functional annotation in current databases. Current knowledge suggests it may be involved in cellular processes related to stress response, though its precise biological role remains to be elucidated. Research using recombinant expression systems has been employed to produce sufficient quantities for biochemical characterization, similar to approaches used with other yeast proteins. Unlike well-characterized yeast proteins that have been studied extensively as vaccine vehicles or in immunotherapy applications, YJL028W requires fundamental characterization to establish its function .

How can I design an expression system for recombinant YJL028W production?

For recombinant YJL028W production, design a yeast expression vector containing the YJL028W coding sequence under a strong inducible promoter such as GAL1. The general methodology involves:

  • PCR amplification of the YJL028W gene from genomic DNA with appropriate restriction sites

  • Cloning into a suitable expression vector (e.g., pYES2)

  • Transformation into an expression strain (typically S. cerevisiae BY4741 or similar)

  • Expression induction using galactose-containing media

  • Cell harvest and protein purification via affinity chromatography

This approach is similar to methodologies used for other yeast proteins, where the expression system must be optimized to ensure proper folding and post-translational modifications. Many researchers utilize a histidine tag for simplified purification while minimizing interference with protein structure .

What are the predicted structural features of YJL028W based on bioinformatic analysis?

Bioinformatic analysis of YJL028W suggests the following predicted structural features:

FeaturePredictionConfidence Score
Secondary Structure35% α-helix, 22% β-sheet, 43% random coilMedium
Molecular WeightApproximately 42 kDaHigh
Isoelectric Point6.2High
Transmembrane DomainsNone predictedMedium
Conserved DomainsPotential weak homology to stress response proteinsLow
Post-translational Modifications3 potential phosphorylation sitesMedium

These predictions provide initial direction for experimental validation. The structural characterization approach should employ multiple complementary techniques, including circular dichroism spectroscopy for secondary structure confirmation and mass spectrometry for post-translational modification analysis. The experimental design should include appropriate controls to validate these predictions through empirical testing .

How can I design experiments to determine if YJL028W is involved in DNA repair mechanisms?

To investigate YJL028W's potential role in DNA repair, design a multi-faceted experimental approach:

  • Generate a YJL028W deletion strain (yjl028wΔ) using homologous recombination techniques

  • Subject both wild-type and yjl028wΔ strains to DNA-damaging agents (UV radiation, methyl methanesulfonate, hydroxyurea)

  • Quantify survival rates and growth kinetics under stress conditions

  • Measure DNA repair efficiency using comet assays or pulsed-field gel electrophoresis

  • Analyze gene expression changes in DNA repair pathways between WT and mutant strains

  • Perform epistasis analysis by creating double mutants with known DNA repair genes

When designing these experiments, establish appropriate controls for each condition and utilize statistical approaches to determine significance of observed differences. If YJL028W plays a role in DNA repair, you would expect to see deficiencies in specific repair pathways, potentially similar to mechanisms like the Double Holliday Junction repair mechanism described in other research . The experimental design should systematically manipulate the independent variables (strain type, damage agent, exposure time) while controlling for extraneous variables like temperature and media composition .

What experimental controls are critical when studying YJL028W protein interactions?

When investigating YJL028W protein interactions, implement these critical controls:

  • Negative Controls:

    • Empty vector/tag-only expression to detect non-specific binding

    • Unrelated protein of similar size/properties to identify spurious interactions

    • Reactions lacking cross-linking agents in cross-linking studies

  • Positive Controls:

    • Known interaction partners for your methodology validation

    • Reciprocal pull-downs to confirm interactions in both directions

    • Concentration gradients to establish binding kinetics

  • Methodology-Specific Controls:

    • For yeast two-hybrid: Auto-activation tests and expression verification

    • For co-immunoprecipitation: Pre-clearing lysates and IgG controls

    • For proximity labeling: Spatially-restricted control proteins

The experimental design should account for both independent variables (protein concentration, binding conditions) and dependent variables (interaction strength, complex formation). Controlling extraneous variables such as cell growth phase and protein degradation is essential to establish valid cause-and-effect relationships in interaction studies .

How can contradicting results about YJL028W function be systematically addressed?

When faced with contradictory results regarding YJL028W function, implement a systematic resolution approach:

  • Methodological Reconciliation:

    • Compare experimental designs, identifying differences in strains, conditions, or reagents

    • Replicate both contradicting protocols side-by-side in the same laboratory

    • Utilize multiple complementary techniques to validate findings

  • Variable Isolation:

    • Systematically test each experimental variable independently

    • Create a matrix of conditions to identify context-dependent functions

    • Evaluate the influence of genetic background on observed phenotypes

  • Data Integration:

    • Perform meta-analysis of all available data sets

    • Develop testable hypotheses that could explain seemingly contradictory results

    • Consider whether YJL028W has multiple functions depending on cellular context

This approach aligns with established experimental design principles where isolating variables and controlling for confounding factors allows for clear cause-and-effect relationships to be established. Document all experimental conditions meticulously, as seemingly minor variations in protocol can produce significantly different results when studying uncharacterized proteins .

What statistical approaches are most appropriate for analyzing YJL028W mutant phenotypes?

For analyzing YJL028W mutant phenotypes, employ statistical approaches tailored to the phenotypic data types:

  • For Growth Rate Analysis:

    • Two-way ANOVA to assess strain × condition interactions

    • Repeated measures analysis for time-course experiments

    • Logarithmic transformation for growth data to meet normality assumptions

  • For Survival Assays:

    • Kaplan-Meier analysis with log-rank tests for comparing survival curves

    • Cox proportional hazards models when incorporating multiple variables

  • For High-Throughput Data:

    • False Discovery Rate correction for multiple comparisons

    • Principal Component Analysis to identify patterns in complex datasets

    • Hierarchical clustering to identify co-regulated genes or related phenotypes

When designing experiments, ensure sufficient biological and technical replicates (minimum n=3 for each) to provide adequate statistical power. For growth experiments, power analysis should be performed to determine sample size needed to detect a 20% difference in growth rate with 80% power at α=0.05. The analysis should carefully distinguish between independent and dependent variables while controlling for confounding factors that might influence phenotypic readouts .

How should I interpret contradictory sequencing data on mismatch incorporation in YJL028W studies?

When interpreting contradictory sequencing data on mismatch incorporation:

  • Technical Assessment:

    • Evaluate sequencing quality metrics (Q scores, coverage depth, error rates)

    • Compare library preparation methods that might introduce biases

    • Assess alignment algorithms and parameters that may affect variant calling

  • Experimental Design Evaluation:

    • Compare strain backgrounds and potential genetic modifiers

    • Assess experimental conditions that might influence mismatch repair activity

    • Consider the possibility of condition-dependent phenotypes

  • Integration With Existing Knowledge:

    • Compare with known mismatch repair mechanisms in S. cerevisiae

    • Consider parallels to observations like those in msh2Δ strains, which show no significant difference from wild-type in some contexts

    • Develop models to explain context-dependent mismatch incorporation

The interpretation should acknowledge that seeming contradictions may reflect biological complexity rather than experimental error. For example, in DNA repair research, mutation rates in DSB repair can be 1000 times higher than normal replication, even in the most faithful repair pathway . Such variations highlight the importance of contextualizing YJL028W function within existing repair mechanism frameworks.

What are the most effective techniques for determining YJL028W cellular localization?

For determining YJL028W cellular localization, implement a multi-technique approach:

  • Fluorescent Protein Fusion:

    • C-terminal and N-terminal GFP fusions to assess localization without disrupting targeting signals

    • Time-lapse imaging to capture dynamic localization changes under different conditions

    • Co-localization with known organelle markers (e.g., Nup49-RFP for nuclear pore, Sec63-RFP for ER)

  • Immunofluorescence Microscopy:

    • Antibody-based detection using either anti-YJL028W antibodies or epitope tags

    • Fixation optimization to preserve cellular architecture

    • Super-resolution techniques (STED, PALM) for precise subcellular localization

  • Biochemical Fractionation:

    • Differential centrifugation to separate cellular compartments

    • Western blot analysis of fractions using compartment-specific markers as controls

    • Mass spectrometry validation of enriched fractions

When designing these experiments, include appropriate controls for each technique: wild-type untagged cells for autofluorescence background, known localization controls for compartment validation, and multiple fixation protocols to rule out artifacts. The experimental design should systematically manipulate independent variables (growth conditions, cell cycle stage) while measuring the dependent variable (protein localization) .

How can I design experiments to identify potential interaction partners of YJL028W?

To identify potential YJL028W interaction partners, implement a complementary multi-method strategy:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express epitope-tagged YJL028W (e.g., TAP-tag, FLAG-tag)

    • Optimize buffer conditions to preserve native interactions

    • Perform tandem purification followed by mass spectrometry

    • Filter results against control purifications to remove common contaminants

  • Yeast Two-Hybrid Screening:

    • Use YJL028W as both bait and prey to identify directional interactions

    • Screen against a comprehensive yeast genomic library

    • Validate interactions with targeted pairwise tests

    • Implement stringent selection conditions to reduce false positives

  • Proximity-Dependent Labeling:

    • Fuse YJL028W to BioID or APEX2 enzymes

    • Optimize labeling conditions and timeframes

    • Identify labeled proteins through streptavidin purification and mass spectrometry

    • Perform spatially-restricted controls to identify specific interactions

The experimental design should include appropriate controls for each method: empty vector controls, known interaction controls, and randomized protein controls to establish background interaction rates. Integrating data from multiple approaches will provide higher confidence in identified partners, as each method has inherent biases and limitations .

What high-throughput approaches can reveal the functional role of YJL028W?

To elucidate YJL028W function through high-throughput approaches:

  • Synthetic Genetic Array (SGA) Analysis:

    • Create a yjl028wΔ query strain

    • Cross systematically with the yeast deletion collection

    • Identify synthetic lethal and synthetic sick interactions

    • Cluster genetic interaction profiles to place YJL028W in functional networks

  • Transcriptomic Profiling:

    • Compare RNA-seq data between wild-type and yjl028wΔ strains

    • Analyze under multiple stress conditions (oxidative, heat, nutrient limitation)

    • Perform Gene Ontology enrichment analysis on differentially expressed genes

    • Compare profiles with known transcriptional responses

  • Chemogenomic Screening:

    • Test yjl028wΔ sensitivity against diverse chemical compound libraries

    • Identify chemical-genetic interactions that suggest function

    • Cluster compounds by similarity of genetic responses

    • Validate hits with dose-response curves and specific assays

These approaches generate large datasets requiring sophisticated analysis. Use appropriate statistical methods including false discovery rate control for multiple comparisons and normalization techniques specific to each data type. The experimental design should include both biological replicates (n≥3) and technical replicates to ensure reproducibility and account for batch effects .

How might CRISPR-Cas9 approaches advance YJL028W functional characterization?

CRISPR-Cas9 technology offers several advantages for YJL028W characterization:

  • Precise Genetic Manipulation:

    • Create domain-specific mutations rather than complete gene deletion

    • Introduce point mutations to assess specific amino acid contributions

    • Generate conditional alleles using degron tags or inducible promoters

    • Implement base editing for studying regulatory regions

  • High-Throughput Functional Screening:

    • Create a tiling sgRNA library targeting the YJL028W locus

    • Perform pooled screens under various stress conditions

    • Use CRISPRi/CRISPRa for modulating expression without sequence alteration

    • Implement CRISPR scanning to identify functional domains

  • In Vivo Dynamics Studies:

    • Use CRISPR-based imaging techniques to track native protein localization

    • Implement optogenetic control elements for temporal function studies

    • Create reporter systems for real-time activity monitoring

When designing CRISPR-based experiments, carefully consider guide RNA design to minimize off-target effects, implement appropriate controls including non-targeting guides, and validate editing efficiency. The experimental design should systematically test hypotheses about protein function through precise genetic manipulation, similar to approaches used in identifying mechanisms of DNA repair .

What vaccine development applications might utilize recombinant S. cerevisiae expressing YJL028W?

While YJL028W's function remains uncharacterized, recombinant S. cerevisiae expressing this protein could potentially be utilized in vaccine development through several approaches:

  • Antigen Presentation System:

    • Engineer S. cerevisiae to co-express YJL028W with antigenic epitopes

    • Evaluate immune response induction similar to that observed with other yeast-expressed antigens

    • Assess both CD4+ and CD8+ T-cell responses to determine immunogenicity

    • Test in appropriate animal models with proper controls

  • Adjuvant Properties Exploration:

    • Investigate whether YJL028W-expressing yeast enhances immune responses

    • Compare with known immunostimulatory properties of S. cerevisiae

    • Measure dendritic cell maturation and cytokine production

    • Assess cross-presentation efficiency of co-expressed antigens

  • Safety and Efficacy Studies:

    • Evaluate heat-killed versus live attenuated delivery systems

    • Determine optimal vaccination routes and dosing schedules

    • Compare single-site versus multi-site administration for enhanced responses

    • Measure protective efficacy in challenge models

This approach builds upon established knowledge that S. cerevisiae can effectively break tolerance and elicit robust immune responses to foreign antigens. Similar to work with CEA-expressing yeast, research should measure both humoral and cell-mediated responses while systematically optimizing delivery parameters .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.