Recombinant Saccharomyces cerevisiae Uncharacterized protein YJL118W (YJL118W)

Shipped with Ice Packs
In Stock

Description

General Information

YJL118W is a putative protein of unknown function in Saccharomyces cerevisiae . Based on co-purification experiments, YJL118W may interact with ribosomes . The YJL118W gene is non-essential, and its deletion enhances the toxicity of heterologously expressed human alpha-synuclein . The protein consists of 219 amino acids .

Protein-Protein Interactions

YJL118W interacts with MBR1 (YKL093W), a protein involved in mitochondrial functions and stress response . Overexpression of MBR1 suppresses growth defects of hap2, hap3, and hap4 mutants, and it has a paralog, ISF1, that arose from whole-genome duplication . Predicted functional partners of YJL118W include MTC1, CRP1, YCR024C-B, SVP26, BUD31, GCD14, CAK1, RRP43, ALB1, and EMG1 .

ProteinDescriptionScore
MTC1Maintenance of telomere capping protein 1; protein of unknown function that may interact with ribosomes; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and to COPI-coated vesicles (early Golgi); mtc1 is synthetically lethal with cdc13-1 0.835
CRP1Protein that binds to cruciform DNA structures; CRP1 has a paralog, MDG1, that arose from the whole genome duplication 0.604
YCR024C-BUncharacterized protein YCR024C-B; putative protein of unknown function; identified by expression profiling and mass spectrometry 0.602
SVP26Integral membrane protein of the early Golgi apparatus and ER; involved in COPII vesicle transport; may also function to promote the retention of proteins in the early Golgi compartment 0.557
BUD31Pre-mRNA-splicing factor BUD31; component of the SF3b subcomplex of the U2 snRNP; increases the efficiency of first and second step pre-mRNA splicing; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern; facilitates passage through G1/S Start but is not required for G2/M transition or exit from mitosis 0.553
GCD14tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61; subunit of tRNA (1-methyladenosine) methyltransferase; required, along with Gcd10p, for the modification of the adenine at position 58 in tRNAs, especially tRNAi-Met; first identified as a negative regulator of GCN4 expression; Belongs to the class I-like SAM-binding methyltransferase superfamily. TRM61 family 0.524
CAK1Serine/threonine-protein kinase CAK1; cyclin-dependent kinase-activating kinase; required for passage through the cell cycle; phosphorylates and activates Cdc28p; the nucleotide-binding pocket differs significantly from those of most other protein kinases 0.446
RRP43Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp43p (OIP2, EXOSC8); protein abundance increases in response to DNA replication stress 0.442
ALB1Ribosome biogenesis protein ALB1; shuttling pre-60S factor; involved in the biogenesis of the ribosomal large subunit; interacts directly with Arx1p; responsible for Tif6p recycling defects in the absence of Rei1p 0.427
EMG1Ribosomal RNA small subunit methyltransferase NEP1; methyltransferase for rRNA; methylates pseudouridine 18S rRNA residue 1191; a member of the SPOUT methyltransferase family; required for maturation of 18S rRNA and for 40S ribosomal subunit production independent of methyltransferase activity; forms homodimers; the human ortholog is mutated in Bowen-Conradi syndrome, and an equivalent yeast mutation affects Emg1p dimerization and localization but not methyltransferase activity; human EMG1 complements lethality of null and ts mutant 0.426

Protein Complexes

Protein complexes in Saccharomyces cerevisiae have been cataloged, with the CYC2008 being a comprehensive catalog of 408 manually curated heteromeric protein complexes . The YHTP2008 comprises 400 complexes derived from genome-wide high-throughput studies . These catalogs are valuable for discovering protein interactions and protein complexes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YJL118W; J0742; Uncharacterized protein YJL118W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL118W
Target Protein Sequence
MASCFSVSLLARVAVVEPIRVQLWLNVVNCMIESSMHQCPPRDRHFFSSSRPILLIRRSV STVYRFVASRTTQVLRAAKTVVKWFIIVDPLINSILINYLIDRLCTLGHAVLRVKKRKTE ERQPCSPIIQHTHVKRRKRPRLRIVAIKRKRRRRRPHRIERPLSNMYPIMEIQMVAVPLA LPSPTALVHYQQQQQQLPQHHPWYDLSLSEEALSTCCCS
Uniprot No.

Target Background

Database Links

KEGG: sce:YJL118W

STRING: 4932.YJL118W

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.