Recombinant Saccharomyces cerevisiae Uncharacterized protein YJL132W (YJL132W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YJL132W; J0678; Uncharacterized protein YJL132W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-750
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJL132W
Target Protein Sequence
MSIISSWLLVSIICLTTSIVTKLQAAGVTTHLFYLTRGAPLSLKENYYPWLKAGSFFPDA LYSCAPSNKDWSDFAEFTHWPNFLMIAVSYWQQKYGQNDRLRGTHGSLALKSFLIGVFTH QIVDVSWHSLVTDYRMHGLLRVLSETEFDGDIETAHTFLDVMGEFLTLNNVIRDSNNNEN WDFLTRSDWKLPREEDLMEIIRNAGLSKEKLSYAELEFCVKRGMAAAISEGYLFRSQRNQ LLTNIYSTSPRANDLILNHWLGGQSNLVAMLQRCVPFFETLFHDENTNEAQAEELRLCAN LPPVSQKRINARPLVSSLKARKGNSHIVVSPMKSFSDFGTSLTMGKFREDNKDYLAVSAP LEDTVGAIYIVPWDILTVARKEDFSILQPITAMYGSKVGTYKASDVDYLLVSQPGTCTID FYFKGVKILTIKDETTEEAHQLQFAVTGNFYDDKIPDLVVSSPSYGANETGIATFIPGSS IISYLTNSDKYQVVDISTFKGVINLDGYPMKIPFQHFGATIQISDTTDKQKLIYITCQSL GTVFVYSSNDLHDLSIPIYYITKNGVIPAKDSDHVEWHIIPSKEHGMFGAAIYSWNFEGM SFVAVSQPMFDTVFIYIEKSGQIEFFLKLVLKIKTKSDSIPDEFGSSLLFNDEEKKLYVS SPGSFDARGSIWKISMDELLKAGNDPKRKTLLINNLRHLMLINPDKSSKGVSNFGNSMIL GPQNHLIVGIPQYGYGNFDHMQLTGRILVL
Uniprot No.

Target Background

Database Links

KEGG: sce:YJL132W

STRING: 4932.YJL132W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant YJL132W production?

For recombinant YJL132W production, E. coli expression systems have proven effective as demonstrated in commercial preparations . The methodology involves:

  • Cloning the YJL132W coding sequence into an appropriate expression vector with a histidine tag

  • Transforming the construct into a competent E. coli strain optimized for protein expression

  • Inducing expression under controlled conditions (temperature, media composition)

  • Cell lysis and purification using nickel affinity chromatography

For researchers seeking yeast-based expression, the pVSec vector system can be employed, similar to the approach used for hemicellulase expression in S. cerevisiae . This involves:

  • Amplifying the YJL132W gene from S. cerevisiae genomic DNA

  • Ligating into the pVSec plasmid at appropriate restriction sites

  • Transforming into S. cerevisiae strains such as DY1457

  • Culturing in Chelex-treated synthetic defined medium (CSD) with controlled zinc levels if studying zinc-dependent regulation

What methodologies are recommended for investigating YJL132W protein interactions?

Multiple complementary approaches are recommended for comprehensive investigation of YJL132W protein interactions:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):

    • Express YJL132W with a TAP (Tandem Affinity Purification) tag in S. cerevisiae

    • Perform cell lysis under non-denaturing conditions

    • Conduct tandem affinity purification followed by mass spectrometry

    • Analyze using label-free spectral counting and normalized spectral abundance factors (dNSAF) methodology

  • Size Exclusion Chromatography:

    • Fractionate YJL132W-TAP elution using Superose 6 size exclusion chromatography

    • Monitor elution by Western blotting using anti-TAP antibodies

    • Identify co-eluting proteins by mass spectrometry in different fractions

    • Compare elution profiles to identify stable protein complexes

  • Yeast Two-Hybrid Screening:

    • Clone YJL132W into appropriate bait vector

    • Screen against a S. cerevisiae genomic library

    • Validate positive interactions through reciprocal tests and co-immunoprecipitation

Published protein interaction data indicates YJL132W engages with approximately 60 interactor proteins across 64 distinct interactions , suggesting involvement in multiple cellular processes.

How can researchers determine the subcellular localization of YJL132W?

To determine YJL132W subcellular localization, employ these methodologies:

  • Fluorescent Protein Tagging:

    • Create a C-terminal GFP fusion with YJL132W using homologous recombination

    • Transform into S. cerevisiae using a high-efficiency method

    • Visualize using confocal microscopy against known organelle markers

    • Verify localization under different growth conditions, especially varying zinc concentrations

  • Subcellular Fractionation and Western Blotting:

    • Prepare membrane, cytosolic, nuclear, and organelle fractions

    • Run Western blots with anti-YJL132W antibodies or tag-specific antibodies

    • Use organelle-specific markers as controls (e.g., Pma1 for plasma membrane)

  • Immunoelectron Microscopy:

    • Fix yeast cells and prepare ultrathin sections

    • Immunolabel with anti-YJL132W antibodies and gold-conjugated secondary antibodies

    • Analyze by transmission electron microscopy

Current evidence indicates that YJL132W localizes to the membrane fraction , but further investigation is required to determine the specific membrane compartment.

How does zinc deficiency affect YJL132W expression?

YJL132W has been identified as a possible Zap1p-regulated target gene induced by zinc deficiency . To investigate this relationship:

  • Zap1p-dependent expression analysis:

    • Use wild-type, zap1Δ mutant, and ZAP1-1up (constitutively active) strains like DY1457, ZHY6, and ZHY7

    • Culture in zinc-limited CSD media and zinc-replete conditions

    • Measure YJL132W transcript levels by RT-qPCR or Northern blotting

    • Compare expression patterns across strains

  • Chromatin Immunoprecipitation (ChIP):

    • Perform ChIP using anti-Zap1p antibodies

    • Amplify YJL132W promoter regions by PCR

    • Quantify enrichment to determine direct Zap1p binding

  • Promoter mutagenesis:

    • Identify putative Zap1p binding sites in the YJL132W promoter

    • Create reporter constructs with mutated binding sites

    • Measure reporter expression in response to zinc limitation

    • Validate functional Zap1p binding sites

The methodology should follow established protocols for studying zinc-responsive genes in S. cerevisiae, with CSD media prepared as described in section 3.1.

How can gene deletion and complementation studies be optimized for YJL132W functional analysis?

For optimal YJL132W gene deletion and complementation studies:

  • Homologous Recombination-Based Gene Deletion:

    • Design deletion cassettes with 50-1000bp homology arms flanking YJL132W

    • Consider using S. cerevisiae strains expressing S. cerevisiae RAD52 for enhanced homologous recombination efficiency (up to 95% with 1000bp homology arms)

    • Transform using lithium acetate method

    • Select transformants on appropriate selective media

    • Verify deletion by PCR and phenotypic analysis

  • Complementation Strategies:

    • Clone YJL132W with native promoter into centromeric and episomal vectors

    • Transform into yjl132wΔ strains

    • Test for rescue of any observed phenotypes

    • Create point mutations or truncations to identify critical residues/domains

  • Conditional Expression Systems:

    • Place YJL132W under control of regulatable promoters (GAL1, TET)

    • Analyze phenotypes under inducing/repressing conditions

    • Use for studying essential functions or dominant-negative effects

For strains with reduced homologous recombination efficiency, consider implementing the S. cerevisiae RAD52 expression strategy that showed 6.5 times higher efficiency than wildtype strains and 1.6 times higher than the traditionally used ku70 disruption strategy .

What approaches can be used to identify the function of YJL132W through interaction network analysis?

To identify YJL132W function through interaction network analysis, implement these methodologies:

  • Integrative Bioinformatics and Quantitative Proteomics:

    • Perform reciprocal analysis of YJL132W protein interactions using TAP-tag purification

    • Analyze by mass spectrometry to identify stable and transient interactions

    • Combine with available genetic interaction data and GO functional associations

    • Generate a focused interaction network as demonstrated for other uncharacterized yeast proteins

  • Comparative Analysis in Gene Deletion Backgrounds:

    • Create H4-TAP and H4-TAP yjl132wΔ strains

    • Compare protein complexes purified from each strain

    • Identify proteins whose association with H4 depends on YJL132W

    • Infer functional relationships by analyzing the affected pathways

  • Gene Ontology Enrichment Analysis:

    • Compile all proteins that interact with YJL132W

    • Perform GOstat analysis to identify overrepresented GO terms

    • Focus on statistically significant biological processes (p-value < 0.01)

    • Validate predictions experimentally

This approach has proven effective for other uncharacterized proteins like YDL156W, which was associated with chromatin remodeling, transcription, and DNA repair/replication through similar methodology .

How should experiments be designed to study YJL132W involvement in chromatin-related processes?

Based on interaction data showing potential connections to histone proteins, design experiments to study YJL132W's role in chromatin-related processes:

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq):

    • Create epitope-tagged YJL132W strains

    • Perform ChIP-seq to identify genomic binding sites

    • Analyze binding patterns relative to known chromatin features

    • Validate with ChIP-qPCR for selected genomic regions

  • RNA-seq in Wild-type vs. yjl132wΔ Strains:

    • Culture strains under standard and stress conditions

    • Extract RNA and perform RNA-seq

    • Analyze differential gene expression

    • Identify affected pathways and gene classes

  • Histone Modification Analysis:

    • Prepare nuclear extracts from wild-type and yjl132wΔ strains

    • Perform Western blotting with antibodies against specific histone modifications

    • Use ChIP-seq to analyze genome-wide distribution of histone modifications

    • Focus on modifications associated with transcriptional regulation

  • Functional Design of Experiments (F-DOE) Approach:

    • Apply F-DOE methodology where the response variable is a function/curve rather than a single value

    • Measure temporal dynamics of chromatin accessibility or histone modification patterns

    • Analyze how multiple factors affect the shape of these curves

    • Use appropriate statistical methods for functional data analysis

Research on other previously uncharacterized proteins has shown that deletion of chromatin-associated factors can dramatically affect histone interactions with RNA polymerase complexes , suggesting similar approaches may reveal YJL132W function.

What are the best strategies for studying potential zinc-dependent functions of YJL132W?

To investigate zinc-dependent functions of YJL132W:

  • Zinc-Limited Growth Conditions:

    • Prepare CSD media with varying zinc concentrations (0-100μM)

    • Compare growth rates and phenotypes of wild-type and yjl132wΔ strains

    • Analyze cellular zinc content using atomic absorption spectroscopy

    • Use ZAP1 deletion and constitutively active mutants as controls

  • Transcriptional Response Analysis:

    • Perform RNA-seq or microarray analysis under zinc-limited conditions

    • Compare transcriptional profiles of wild-type and yjl132wΔ strains

    • Identify differentially regulated pathways

    • Focus on genes with known zinc-responsive elements

  • Protein-Metal Interaction Studies:

    • Express and purify recombinant YJL132W

    • Measure zinc binding using isothermal titration calorimetry

    • Identify zinc-binding motifs through site-directed mutagenesis

    • Analyze structural changes upon zinc binding using circular dichroism

  • Global Proteomic Response:

    • Apply quantitative proteomics (SILAC or TMT labeling)

    • Compare proteomes of wild-type and yjl132wΔ strains under zinc-limited conditions

    • Identify proteins whose abundance or modification state depends on YJL132W

    • Validate key findings by Western blot or targeted proteomics

These approaches should be implemented using the zinc-limitation methodology established for studying Zap1p-regulated genes , with careful attention to metal contamination during experimental procedures.

What methods are recommended for structural characterization of YJL132W?

For comprehensive structural characterization of YJL132W, employ these methodologies:

Given YJL132W's membrane localization , consider detergent screening or nanodiscs for optimal protein preparation while maintaining native conformation.

How can researchers identify functional domains within YJL132W?

To identify functional domains within YJL132W:

  • Bioinformatic Analysis:

    • Perform sequence alignment with homologous proteins

    • Apply domain prediction tools (InterPro, SMART, Pfam)

    • Identify conserved motifs and potential functional sites

    • Use secondary structure prediction to identify structured regions

  • Limited Proteolysis:

    • Digest purified YJL132W with various proteases

    • Identify stable fragments by SDS-PAGE and mass spectrometry

    • Clone and express stable domains

    • Test domains for specific functions and interactions

  • Truncation and Deletion Analysis:

    • Create systematic N- and C-terminal truncations

    • Generate internal deletions of predicted domains

    • Express in S. cerevisiae and assess functionality

    • Map regions essential for localization and protein interactions

  • Site-Directed Mutagenesis:

    • Identify conserved residues through sequence alignment

    • Create point mutations targeting these residues

    • Assess effects on protein function, localization, and interactions

    • Focus on potential zinc-coordinating residues if studying zinc-dependent functions

  • Cross-linking Mass Spectrometry:

    • Apply protein cross-linking reagents to purified YJL132W or in vivo

    • Identify cross-linked peptides by mass spectrometry

    • Map spatial relationships between protein regions

    • Infer domain organization and tertiary structure

These methodologies have proven effective for functional characterization of other previously uncharacterized yeast proteins and should provide valuable insights into YJL132W structure-function relationships.

How can researchers integrate multiple datasets to develop comprehensive models of YJL132W function?

For integrative systems biology analysis of YJL132W function:

  • Multi-omics Data Integration:

    • Combine proteomics, transcriptomics, and genetic interaction data

    • Apply structure equation modeling (SEM) to analyze relationships between variables8

    • Generate statistical models of causal relationships

    • Validate predictions experimentally

  • Network Analysis and Visualization:

    • Construct protein-protein interaction networks centered on YJL132W

    • Apply graph theory algorithms to identify key nodes and modules

    • Determine betweenness centrality and other network metrics

    • Use tools like Cytoscape for visualization and analysis

  • Bayesian Network Modeling:

    • Develop probabilistic graphical models from experimental data

    • Infer causal relationships between YJL132W and other genes/proteins

    • Update models iteratively as new data becomes available

    • Use for generating testable hypotheses

  • Constraint-Based Modeling:

    • Integrate YJL132W into genome-scale metabolic models of S. cerevisiae

    • Predict metabolic consequences of YJL132W perturbations

    • Apply flux balance analysis to identify affected pathways

    • Validate predictions with metabolomics data

  • Component Analysis Using Single-Subject Experimental Designs:

    • Apply notation systems to evaluate different experimental designs

    • Systematically test individual components of complex phenotypes

    • Use for dissecting multifaceted functions of YJL132W

    • Build comprehensive functional models from component analyses

This integrative approach has been successful for characterizing previously uncharacterized proteins like YDL156W, which was implicated in multiple processes through systematic analysis of protein interactions and genetic data .

What considerations are important when using S. cerevisiae as a model for studying YJL132W orthologs in other organisms?

When studying YJL132W orthologs in other organisms using S. cerevisiae as a model:

  • Phylogenetic Analysis and Ortholog Identification:

    • Perform comprehensive sequence similarity searches across species

    • Construct phylogenetic trees to identify true orthologs

    • Analyze conservation of key domains and motifs

    • Consider evolutionary rate and selection pressure

  • Complementation Testing:

    • Clone putative orthologs from other species

    • Express in yjl132wΔ S. cerevisiae strains

    • Assess rescue of any observable phenotypes

    • Identify functionally conserved regions through domain swapping

  • Comparative Functional Genomics:

    • Compare genetic interaction profiles across species

    • Analyze conservation of protein-protein interactions

    • Identify conserved and divergent functions

    • Consider organism-specific adaptations

  • Model Selection Considerations:

    • Assess whether S. cerevisiae is representative for the specific process under study

    • Consider that S. cerevisiae may not be suitable for all biological processes

    • Evaluate the evolutionary distance between species of interest

    • Account for potential neofunctionalization or subfunctionalization events

  • Translational Aspects:

    • When studying human orthologs, consider fundamental differences in cellular physiology

    • Pay attention to differential protein localization across species

    • Account for differences in post-translational modifications

    • Consider context-dependent functions in multicellular organisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.