Recombinant Saccharomyces cerevisiae Uncharacterized protein YJR012C (YJR012C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YJR012C; J1440; YJR83.25; Uncharacterized protein YJR012C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-207
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJR012C
Target Protein Sequence
MTVQSSPILRQSSFNFITFYLACQLLTFLCIYIVFFFVKFLPTIKVSFIIIGACKRAPHV SVYLLKIDCEHNESSMAAGGELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRP RPRPWEGQLQHQSHQGSLDKPNISLDIDQESLEGMTSLTRLSECYDIQSKLQINDSDNDN DDNNNDNNKGDGNDDDNNTVTANPTAR
Uniprot No.

Target Background

Database Links

KEGG: sce:YJR012C

STRING: 4932.YJR012C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YJR012C and why is it significant for yeast researchers?

YJR012C is an uncharacterized protein in Saccharomyces cerevisiae with proposed involvement in transport mechanisms, based on mass spectrometry analysis of copurifying proteins. The significance of this protein lies in its initially misleading annotation history and its potential role in cellular transport pathways. Originally considered essential, subsequent research suggests a possible misannotation of its start codon, which had erroneously indicated an overlap with the neighboring ORF GPI14/YJR013W. Further investigation has demonstrated that null mutants containing a deletion from the proposed true start codon at M76 to the end of the ORF are viable, challenging earlier assumptions about its essentiality . The protein represents an excellent case study for annotation refinement in genomics and highlights the importance of experimental validation of computational predictions in functional genomics.

What phenotypic data exists for YJR012C deletion mutants?

Several screening studies have generated phenotypic data for YJR012C deletion mutants under various conditions. The data reveals differential growth responses to various compounds, as demonstrated in the following table:

Screen ConditionNormalized Phenotypic Value (NPV)Percentile
Gossypol [300 uM] in YPD + DMSO [2%] (Prescott & Hoepfner, 2018)0.0120.00%
2-amino-3-methylimidazo[4,5-f] quinoline [400 uM] in YPD + MeOH [2%] (Dolan & Fasullo, 2023)0.1040.00%
2-amino-3-methylimidazo[4,5-f] quinoline [800 uM] in YPD + MeOH [2%] (Dolan & Fasullo, 2023)0.6760.00%
2-amino-3-methylimidazo[4,5-f] quinoline [800 uM] with human CYP1A2 and NAT2 expression in SC - Ura + MeOH [2%] (Dolan & Fasullo, 2023)0.9880.00%
2-amino-3-methylimidazo[4,5-f] quinoline [400 uM] with human CYP1A2 and NAT2 expression in SC - Ura + MeOH [2%] (Dolan & Fasullo, 2023)1.42100.00%

These phenotypic values suggest that YJR012C may play a role in cellular responses to xenobiotic compounds, with particularly strong growth effects observed when human metabolic enzymes CYP1A2 and NAT2 are co-expressed . The progressive increase in NPV with increasing experimental complexity suggests potential interactions between YJR012C and xenobiotic metabolism pathways.

What are the recommended methods for studying uncharacterized proteins like YJR012C in S. cerevisiae?

For uncharacterized proteins like YJR012C, a multi-faceted experimental approach is recommended. Begin with precise gene deletion using CRISPR-Cas9 or traditional homologous recombination methods, ensuring the correct start codon (M76 for YJR012C) is considered . Phenotypic profiling should follow, using both targeted assays based on predicted functions and broader phenotypic screens like those documented in YeastPhenome.org. For YJR012C specifically, transport-related assays would be prudent given its proposed involvement in transport mechanisms.

Protein localization studies using GFP-tagging or immunofluorescence microscopy can provide insights into subcellular localization. For interaction studies, co-immunoprecipitation followed by mass spectrometry analysis can validate and expand on the copurifying proteins that initially suggested YJR012C's transport role. Modern approaches like ReporterSeq can be particularly valuable, as they allow assessment of genetic regulators of transcriptional pathways on a genome-wide scale without requiring cell enrichment or single-cell isolation .

Comparative genomics across yeast species can provide evolutionary context, while transcriptomic analysis under various stress conditions can reveal regulatory patterns. For YJR012C, testing growth responses to compounds like gossypol and 2-amino-3-methylimidazo[4,5-f] quinoline under different genetic backgrounds (such as with human CYP1A2 and NAT2 expression) has already yielded informative phenotypic data and could be expanded further.

How can ReporterSeq be applied to study YJR012C's potential role in stress responses?

ReporterSeq represents a powerful approach for investigating YJR012C's potential involvement in stress responses, particularly the heat shock response (HSR). This method links RNA-encoded barcode levels to pathway-specific output under genetic perturbations, allowing pooled pathway activity measurements via DNA sequencing without requiring cell enrichment or single-cell isolation .

To apply ReporterSeq to YJR012C, researchers would first need to include sgRNAs targeting YJR012C in their CRISPRi library, paired with multiple random barcodes to minimize the effects of barcode bias on reporter mRNA stability. The reporter construct would contain an Hsf1-responsive synthetic promoter (built upon a 'crippled' CYC1 promoter sequence) driving expression of a barcode-containing mRNA .

After library transformation and experimental treatment, both RNA and DNA would be isolated. The RNA counts for a given barcode are proportional to the total transcriptional output of cells containing that barcode, while DNA barcode counts reflect cell numbers. The RNA/DNA ratio indicates the activity of the reporter under the influence of YJR012C knockdown . By exposing the same pool of yeast to multiple stress conditions, researchers could directly compare RNA counts between samples to compute gene-stressor interactions specific to YJR012C.

This approach would allow researchers to determine whether YJR012C functions as a stress-specific, time-specific, or constitutive regulator of the heat shock response, providing valuable insights into its biological function in cellular stress adaptation.

What strategies can be employed to validate the proposed transport function of YJR012C?

To validate YJR012C's proposed transport function, researchers should implement a multi-dimensional validation strategy. Begin with subcellular localization studies using fluorescent protein tagging to determine whether YJR012C localizes to membranes or transport-related organelles. Complement this with membrane fractionation and western blotting to biochemically confirm its association with membrane components.

Functional transport assays should be designed based on the specific transport process YJR012C might mediate. These could include measuring the uptake or efflux of radioactively labeled substrates in wild-type versus YJR012C deletion strains. The phenotypic data showing differential responses to xenobiotic compounds like gossypol and 2-amino-3-methylimidazo[4,5-f] quinoline suggests that transport of these compounds or their metabolites could be relevant targets for such assays.

Protein interaction studies should be expanded beyond the initial mass spectrometry analysis that suggested transport involvement. Techniques such as yeast two-hybrid, proximity labeling, or co-immunoprecipitation followed by mass spectrometry can identify binding partners. Particular attention should be paid to interactions with known transport proteins or regulators.

Physiological studies comparing wild-type, deletion, and overexpression strains under conditions that challenge different transport pathways (ionic stress, nutrient limitation, xenobiotic exposure) could reveal functional consequences of YJR012C manipulation. The existing phenotypic data showing enhanced growth in the presence of human CYP1A2 and NAT2 expression systems provides a starting point for these investigations.

How should researchers interpret the variable phenotypic responses of YJR012C deletion mutants across different screening conditions?

The variability in phenotypic responses of YJR012C deletion mutants across different screening conditions requires careful contextual interpretation. The normalized phenotypic values (NPVs) range from 0.01 (20th percentile) in response to gossypol to 1.42 (100th percentile) when exposed to 2-amino-3-methylimidazo[4,5-f] quinoline in the presence of human CYP1A2 and NAT2 expression . This wide range suggests condition-specific functionality rather than a constitutive role.

When analyzing such data, researchers should first consider the directionality of effects. Low NPVs (below 1.0) generally indicate growth inhibition compared to the population average, while values above 1.0 suggest enhanced growth. The progressive increase in NPVs observed with increasing concentrations of 2-amino-3-methylimidazo[4,5-f] quinoline and the addition of human metabolic enzymes points toward a potential role for YJR012C in xenobiotic metabolism or transport.

The context-dependency of these phenotypes warrants investigation into potential interactions between YJR012C and the introduced human enzymes CYP1A2 and NAT2. One hypothesis might be that YJR012C normally functions to export toxic metabolites produced by these enzymes, with its deletion creating a growth advantage when these enzymes are present. Alternatively, YJR012C might compete with beneficial metabolic pathways activated by these enzymes.

To rigorously interpret these phenotypic patterns, researchers should design follow-up experiments that specifically test these hypotheses, potentially using metabolomic approaches to identify accumulating compounds in deletion mutants or transport assays to directly measure the movement of relevant metabolites.

What bioinformatic approaches can predict the function of YJR012C based on sequence and structural features?

Structural prediction has advanced significantly with AlphaFold2 and RoseTTAFold, which can generate high-confidence protein structure models even for proteins with no detectable sequence homology to known structures. These predicted structures can be compared against structural databases like DALI or CATHEDRAL to identify potential structural homologs that might share functional properties despite sequence divergence.

Genomic context analysis provides another layer of prediction. Researchers should examine conserved gene neighborhoods across yeast species, as functionally related genes often cluster together. Co-expression analysis using publicly available transcriptomic data can identify genes with similar expression patterns to YJR012C, potentially revealing functional associations.

Phylogenetic profiling, which examines the co-occurrence patterns of genes across species, can identify genes with similar evolutionary histories that might be functionally linked to YJR012C. Finally, integration of these predictions with the experimental phenotypic data available for YJR012C can provide a more robust functional hypothesis, especially regarding its potential role in xenobiotic transport or metabolism.

How can researchers distinguish between direct and indirect effects when studying YJR012C's impact on cellular processes?

Distinguishing between direct and indirect effects of YJR012C on cellular processes requires a multi-pronged experimental strategy designed to establish causality. Time-resolved studies represent a critical approach - monitoring cellular changes immediately following YJR012C perturbation can help identify primary effects before secondary adaptations occur. Acute inactivation techniques such as auxin-inducible degron systems or temperature-sensitive alleles provide advantages over traditional deletion approaches by minimizing compensatory adaptations.

Dose-dependency experiments, where YJR012C expression is titrated across a range of levels, can help establish quantitative relationships between YJR012C abundance and phenotypic outcomes. Direct physical interaction studies using techniques like proximity labeling, FRET, or co-immunoprecipitation can confirm whether YJR012C directly interacts with components of the cellular processes it appears to influence.

Epistasis analysis represents another powerful approach, where double mutants combining YJR012C deletion with mutations in genes of known function are examined. The pattern of genetic interactions can reveal whether YJR012C acts upstream, downstream, or in parallel to known pathways. Complementation assays with specific YJR012C domains can identify which regions of the protein are necessary and sufficient for particular cellular effects.

For YJR012C specifically, the varying phenotypic responses observed in different screening conditions suggest context-dependent functionality. Researchers should design experiments that test whether these phenotypes result from direct interactions between YJR012C and the introduced compounds or represent indirect consequences of broader cellular adaptations.

How might YJR012C interact with human xenobiotic metabolism enzymes CYP1A2 and NAT2 in engineered yeast systems?

The phenotypic data showing enhanced growth of YJR012C deletion mutants in the presence of human CYP1A2 and NAT2 expression systems presents an intriguing research direction. YJR012C may function in xenobiotic transport pathways that interact with these human enzymes in recombinant systems. One hypothesis is that YJR012C normally exports metabolites generated by CYP1A2 and NAT2, with its deletion potentially allowing beneficial metabolites to accumulate intracellularly.

To investigate these interactions, researchers should first examine the localization patterns of YJR012C, CYP1A2, and NAT2 in the engineered yeast system to determine if they occupy proximal subcellular regions. Metabolomic profiling comparing wild-type and YJR012C deletion strains expressing the human enzymes could identify differentially accumulated compounds, particularly focusing on known CYP1A2 and NAT2 metabolites of 2-amino-3-methylimidazo[4,5-f] quinoline.

Transport assays using fluorescently labeled or radioactively tagged substrates for CYP1A2 and NAT2 would allow direct measurement of transport activities in the presence and absence of YJR012C. Protein-protein interaction studies could determine whether YJR012C physically interacts with these human enzymes or with yeast proteins involved in similar metabolic pathways.

The observed dose-dependent effect of 2-amino-3-methylimidazo[4,5-f] quinoline concentration on growth phenotypes suggests conducting detailed dose-response studies across a broader concentration range. Combining these approaches would provide mechanistic insights into how YJR012C functionally interacts with human xenobiotic metabolism enzymes in engineered yeast systems, with potential applications for xenobiotic metabolism research and drug development.

What role might YJR012C play in the yeast heat shock response based on recent high-throughput genetic studies?

While direct evidence linking YJR012C to the heat shock response (HSR) is not explicitly stated in the provided search results, methodologies like ReporterSeq offer promising approaches to investigate this potential connection. ReporterSeq can comprehensively identify genes regulating stress-induced transcription factors under multiple conditions in a time-resolved manner . This approach could be specifically applied to examine YJR012C's potential role in HSR regulation.

To investigate YJR012C's role in the HSR, researchers could utilize CRISPRi to knockdown YJR012C expression in a ReporterSeq system with an Hsf1-responsive synthetic promoter. By comparing RNA/DNA ratios of reporter barcodes between YJR012C knockdown and control strains across multiple stress conditions and timepoints, researchers could determine whether YJR012C functions as a stress-specific, time-specific, or constitutive regulator of the HSR .

The observation that YJR012C deletion mutants show variable phenotypic responses to different stressors suggests it might function in stress-responsive pathways, potentially including the HSR. Given that the HSR protects cells from proteotoxicity by increasing expression of protective proteins , and YJR012C is proposed to be involved in transport mechanisms , one hypothesis is that YJR012C might facilitate the transport of misfolded proteins or proteotoxic compounds during stress responses.

Complementary approaches like analyzing YJR012C expression patterns during heat shock, examining physical interactions between YJR012C and known HSR components, and conducting epistasis experiments with HSR regulators would provide a comprehensive understanding of YJR012C's potential role in this critical stress response pathway.

How can systems biology approaches integrate data from different sources to elucidate YJR012C function?

Systems biology approaches offer powerful frameworks for integrating diverse data types to elucidate YJR012C function. A multi-omics integration strategy would combine transcriptomic, proteomic, metabolomic, and phenomic data to build a comprehensive functional profile. Gene co-expression networks constructed from large-scale transcriptomic datasets can position YJR012C within specific functional modules. Protein interaction networks derived from high-throughput methods like affinity purification-mass spectrometry can identify physical interactors, while genetic interaction networks from techniques like synthetic genetic array analysis can reveal functional relationships.

Machine learning approaches can integrate these heterogeneous data types to predict YJR012C function. Supervised learning methods trained on known functional categories can classify YJR012C based on its data signatures, while unsupervised methods can identify patterns in the data that might suggest novel functional roles. The phenotypic data already available for YJR012C provides an excellent starting point for these analyses.

Flux balance analysis could incorporate YJR012C into genome-scale metabolic models, especially given its potential role in xenobiotic transport. By constraining these models with experimental data on growth rates under different conditions, researchers can predict metabolic fluxes affected by YJR012C deletion or overexpression.

Comparative systems biology, examining the function of YJR012C orthologs or functional analogs across different yeast species, can provide evolutionary context. The integration of ReporterSeq data could further enhance this systems approach by providing dynamic, condition-specific information about YJR012C's regulatory relationships. This integrated systems biology strategy would transform the disparate data points currently available for YJR012C into a coherent functional hypothesis that could guide targeted experimental validation.

What emerging technologies could accelerate characterization of uncharacterized proteins like YJR012C?

Emerging technologies across multiple fields are poised to accelerate the characterization of uncharacterized proteins like YJR012C. In structural biology, cryo-electron microscopy advances now enable high-resolution structural determination of membrane proteins without crystallization, which could be particularly valuable for YJR012C given its proposed transport function . AlphaFold2 and similar AI-driven structure prediction tools can generate high-confidence structural models that suggest functional domains and binding interfaces, even for proteins with no detectable sequence homology to known structures.

CRISPR-based technologies beyond basic gene editing offer transformative approaches. CRISPRi and CRISPRa enable precise modulation of gene expression, while CRISPR-X and base editors allow targeted mutagenesis to create allelic series for structure-function studies. Single-cell technologies like single-cell RNA-seq combined with CRISPR perturbations (CROP-seq) can reveal cell-type-specific functions and regulatory relationships at unprecedented resolution.

Mass spectrometry-based interactomics approaches like proximity labeling (BioID, APEX) can map protein interaction networks in their native cellular context, while chemoproteomics can identify small molecule binding partners. These techniques could help identify the transport substrates of YJR012C. Spatial transcriptomics and proteomics technologies can reveal the subcellular localization dynamics of YJR012C and its interaction partners under different conditions.

The ReporterSeq methodology described in the search results represents another promising approach, enabling genome-wide assessment of genetic regulators of transcriptional pathways with the scale of pooled genetic screens and the precision of pathway-specific readouts. Applied to YJR012C, these technologies collectively promise to rapidly advance our understanding of this uncharacterized protein's function in cellular physiology.

How might understanding YJR012C function contribute to metabolic engineering applications in S. cerevisiae?

Understanding YJR012C's function could significantly impact metabolic engineering applications in S. cerevisiae, particularly if its proposed transport role is confirmed. As a potential transporter, YJR012C might be engineered to enhance the uptake of precursors or export of valuable products in metabolically engineered strains. The phenotypic data showing interactions with human xenobiotic metabolism enzymes CYP1A2 and NAT2 suggests YJR012C might be particularly relevant for engineering strains that produce complex secondary metabolites requiring multiple enzymatic modifications.

In the context of recombinant S. cerevisiae strains engineered to produce sugar alcohols like xylitol and ribitol from glucose , understanding YJR012C's transport capabilities could potentially enhance product export, reducing intracellular accumulation and associated toxicity. If YJR012C functions in stress response pathways, as suggested by its variable phenotypic responses to different stressors , modulating its expression could improve strain robustness under the stressful conditions common in industrial fermentation processes.

The observation that YJR012C was initially misannotated highlights the importance of accurate genome annotation for metabolic modeling and strain design. Improving the functional annotation of uncharacterized proteins like YJR012C enhances the accuracy of genome-scale metabolic models used to predict optimal engineering strategies. Furthermore, if YJR012C proves to be a transporter for specific metabolites, it could become a valuable reporter for high-throughput screening systems monitoring these metabolites in engineered strains.

Methodologically, techniques like ReporterSeq used to study YJR012C could be adapted for rapid screening of genetic perturbations that enhance desired metabolic outputs in engineered strains. This application demonstrates how basic research on uncharacterized proteins ultimately feeds into applied biotechnology development.

What are the implications of YJR012C study for understanding the evolution of uncharacterized proteins in fungal genomes?

The study of YJR012C has broader implications for understanding the evolution of uncharacterized proteins in fungal genomes. YJR012C's annotation history, including its initial misclassification as an essential gene due to a potentially incorrect start codon assignment , highlights the challenges in accurately identifying and characterizing genes in even well-studied organisms like S. cerevisiae. This case underscores the potential prevalence of annotation errors in less-studied fungal genomes and the importance of experimental validation.

The fact that YJR012C has remained functionally uncharacterized despite S. cerevisiae being one of the most thoroughly studied model organisms suggests that similar knowledge gaps likely exist across fungal genomics. These uncharacterized proteins may represent novel biological functions that have evolved in specific fungal lineages or highly diverged versions of known functions that have evolved beyond recognition by sequence similarity alone.

Comparative genomic approaches studying YJR012C orthologs across different fungal species could reveal patterns of sequence conservation, adaptation, or loss that correlate with specific ecological niches or metabolic capabilities. Such evolutionary patterns might provide clues to function based on the principle that proteins with shared functions often experience similar selective pressures across species.

The observation that YJR012C deletion affects growth responses to xenobiotics, particularly in the presence of human metabolic enzymes , raises interesting questions about the evolution of detoxification systems across eukaryotes. This suggests potential evolutionary adaptation to environmental toxins that could be explored through broader phylogenetic studies. Furthermore, understanding how uncharacterized proteins like YJR012C participate in stress responses could reveal novel aspects of stress adaptation mechanisms that have evolved in fungi, contributing to our fundamental understanding of eukaryotic cellular biology and the evolution of stress response networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.