Recombinant Saccharomyces cerevisiae Uncharacterized protein YJR112W-A (YJR112W-A)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant YJR112W-A is expressed in E. coli and purified using affinity chromatography. Key production parameters are:

ParameterDetail
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Storage Conditions-20°C/-80°C (long-term); 4°C (working aliquots)
StabilityAvoid repeated freeze-thaw cycles; glycerol (5–50%) recommended for stabilization .

Research Findings and Functional Insights

Despite its classification as “uncharacterized,” YJR112W-A has been implicated in broader genomic and functional studies:

3.1. Core Gene Status and Evolution

  • Core Gene Membership: YJR112W-A is part of the S. cerevisiae core gene set, though its function remains unknown. Core genes are typically essential or conserved across strains .

  • Splicing Efficiency: While not directly linked to YJR112W-A, studies on S. cerevisiae intron-containing genes suggest that uncharacterized proteins may influence splicing fidelity. For example, alternative splice sites in yeast often produce non-functional transcripts degraded by nonsense-mediated decay (NMD) .

Potential Applications in Research

ApplicationRationale
Protein Interaction MappingHis-tagged YJR112W-A can be used in pull-down assays to identify binding partners .
Functional GenomicsCRISPR/Cas9 knockouts or overexpression studies to probe phenotypic effects.
Splicing StudiesInvestigating roles in RNA processing, given S. cerevisiae’s reliance on NMD for quality control .

Challenges and Future Directions

  • Functional Elucidation: The lack of annotated pathways or homologs limits mechanistic understanding. Comparative genomics across fungi (e.g., Ashbya gossypii) may reveal conserved roles .

  • Structural Studies: AlphaFold models (e.g., from ) could predict tertiary structure, guiding hypothesis-driven experiments.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YJR112W-A; Uncharacterized protein YJR112W-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJR112W-A
Target Protein Sequence
MVQLRRTITTNKVFQAITSTNDKVAHFVVFMWESWLFVKMFAEDIVTFRKLQANKYVLGV LICSLCASVTSEFAQSVVSRGQRVFDVKDIICNFWGSLLGVGIAFYQDR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is YJR112W-A and where is it localized in yeast cells?

YJR112W-A (now also known as YFS2) is a putative protein of unknown function in Saccharomyces cerevisiae. Localization studies using SWAT-GFP and mCherry fusion proteins have demonstrated that this protein localizes to the endoplasmic reticulum. The gene was initially identified based on sequence homology to Ashbya gossypii, but its precise molecular function remains undetermined. Recent research in 2025 has revealed that this protein is actually expressed through a complex mechanism involving +1 ribosomal frameshifting, leading to its alternative designation as YFS2 (Yeast FrameShifting 2) .

What is the current understanding of YJR112W-A's gene structure and expression?

The highest ribosome protected fragment (RPF) density matches an ORF initiated with the most 5' end AUG codon and spans the region previously annotated as an intron and part of the second annotated exon. This ORF contains a CUU_A.GG_C heptamer sequence that triggers +1 ribosomal frameshifting at approximately 40% efficiency, resulting in translation continuing in the +1 reading frame . This mechanism allows a single mRNA to encode a protein from two overlapping reading frames.

What phenotypic effects are associated with YJR112W-A mutations?

Extensive phenotypic screening has revealed that YJR112W-A/YFS2 affects multiple cellular processes. The table below summarizes key phenotypic data:

ConditionNPVPercentileEffect on YJR112W-A mutant
Sulfur dioxide [1-2.5 mM]-3.500.35%Extreme sensitivity
Plant defensin NbD6 [3 μM]-2.100.70%High sensitivity
Plant defensin SBI6 [5 μM]-1.871.05%High sensitivity
Sodium abundance-1.561.40%Decreased levels
Temperature oscillation-1.421.75%Growth defect
5-fluoro-cytosine [0.04 μg/ml]5.17100.00%Extreme resistance
H3K79 methylation3.3699.65%Increased methylation
Rapamycin [10 ng/ml]1.9799.30%Resistance
CrO3 [0.1 mM]1.5998.95%Resistance

This diverse range of phenotypes suggests potential roles in stress response, cell wall integrity, and possibly chromatin regulation . The extreme sensitivity to sulfur dioxide and plant defensins, contrasted with strong resistance to 5-fluoro-cytosine, indicates complex and potentially condition-specific functions.

What experimental methods are commonly used to study YJR112W-A?

Researchers investigating YJR112W-A/YFS2 typically employ several complementary approaches:

  • Localization studies using fluorescent protein fusions (SWAT-GFP, mCherry) to determine subcellular distribution

  • Phenotypic screening across various stress conditions and chemical treatments

  • Ribosome profiling to analyze translation dynamics and detect frameshifting events

  • RNA-seq for transcript structure and expression level analysis

  • Reporter assays (such as dual-luciferase systems) to quantify frameshifting efficiency

  • Comparative sequence analysis across Saccharomyces species to identify conserved elements

  • Genetic manipulation techniques including gene deletion, site-directed mutagenesis, and overexpression

For studying the recently discovered frameshifting mechanism specifically, ribosome profiling has proven particularly valuable, as it allows precise mapping of ribosome positions on the mRNA with nucleotide resolution .

How was YJR112W-A/YFS2 discovered to be a frameshifting gene?

The discovery that YJR112W-A undergoes +1 ribosomal frameshifting resulted from careful analysis of ribosome profiling data. Researchers noticed an unusual distribution of ribosome protected fragments (RPFs) in the YJR112W-A locus. While examining the ORF sequence, they identified the presence of a CUU_A.GG_C heptamer, a sequence known to promote +1 ribosomal frameshifting in yeast .

The ribosome footprint density pattern provided clear evidence: high density in the zero-frame ORF followed by continued but lower density matching the +1 reading frame downstream of the heptamer. This pattern is characteristic of programmed ribosomal frameshifting. When tested in its native context, the YJR112W-A/YFS2 frameshifting site showed approximately 40% efficiency, consistent with the typical efficiency of the CUU_A.GG_C heptamer in other contexts .

How does the +1 ribosomal frameshifting mechanism operate in YJR112W-A/YFS2?

The +1 ribosomal frameshifting in YJR112W-A/YFS2 centers on the conserved CUU_A.GG_C heptamer sequence. During translation, when the ribosome encounters this sequence, approximately 40% of ribosomes shift one nucleotide forward (+1 direction) and continue translation in the new reading frame . This mechanism allows a single mRNA to produce a protein encoded by two overlapping reading frames.

The mechanism likely involves specific interactions between the translating ribosome, the CUU_A codon in the A-site, and the corresponding tRNA. The presence of specific codons at the P-site and A-site creates a situation where the ribosome has a significant probability of shifting to the +1 frame before continuing translation. Unlike some other frameshifting cases in yeast (such as ABP140, which shows 60% efficiency), YJR112W-A/YFS2 appears to lack additional stimulatory elements that would enhance frameshifting beyond the basic efficiency of the CUU_A.GG_C heptamer .

The frameshifting site in YJR112W-A/YFS2 occurs close to the 5' end of the mRNA transcript, similar to the pattern observed in YFS1, another recently discovered frameshifting gene in yeast. This positional similarity may indicate a common regulatory strategy or functional constraint on frameshifting placement .

What is the significance of the conserved CUU_A.GG_C heptamer in YJR112W-A/YFS2?

The CUU_A.GG_C heptamer in YJR112W-A/YFS2 has profound significance for both gene function and evolutionary understanding:

  • Evolutionary conservation: Sequence alignments of YFS2/YJR112W-A orthologs across Saccharomyces species demonstrate universal conservation of the CUU_A.GG_C pattern. This conservation strongly suggests the sequence evolves under purifying selection, indicating functional importance of the frameshifting mechanism for fitness .

  • Frameshifting efficiency: This heptamer sequence confers approximately 40% frameshifting efficiency in YFS2, ensuring substantial production of the frameshifted protein variant. This relatively high efficiency suggests the frameshifted product plays a significant functional role .

  • Genomic annotation implications: The discovery of this frameshifting mechanism revealed limitations in current genome annotation pipelines, which failed to correctly annotate YJR112W-A. This highlights how complex translational mechanisms can lead to annotation errors even in well-studied organisms like S. cerevisiae .

  • Comparative insights: The CUU_A.GG_C heptamer is utilized by multiple yeast genes (including YFS2, YFS1, and ABP140) but with different efficiencies. This variation suggests context-dependent modulation of frameshifting, potentially serving as a regulatory mechanism .

The universal conservation of this sequence element across Saccharomyces species provides compelling evidence that the frameshifting mechanism serves an important biological function, rather than representing a translation error or evolutionary artifact.

How does YJR112W-A/YFS2 compare to other known frameshifting cases in yeast?

YJR112W-A/YFS2 represents a distinct case of programmed +1 ribosomal frameshifting in yeast, with several notable comparisons to other known examples:

  • Comparison with ABP140: Both YFS2 and ABP140 utilize the CUU_A.GG_C heptamer for frameshifting, but ABP140 demonstrates higher frameshifting efficiency (~60% versus ~40% for YFS2). This difference suggests that ABP140 contains additional stimulatory elements that enhance frameshifting beyond what is observed in YFS2 .

  • Similarity to YFS1: Both YFS2 and YFS1 contain their frameshifting heptamers positioned near the 5' end of their mRNA transcripts. This positional similarity suggests a potential functional pattern in the arrangement of frameshifting genes .

  • Lack of additional regulatory elements: Unlike some frameshifting cases that contain stimulatory or attenuatory sequence elements, YFS2 appears to rely solely on the intrinsic efficiency of the CUU_A.GG_C heptamer without proximal modulating sequences .

  • Annotation correction case: YFS2 is particularly notable as a case where the frameshifting mechanism led to incorrect genome annotation, having been previously misidentified as an intron-containing gene rather than a frameshifting gene .

These comparisons provide valuable insights into the diversity of frameshifting mechanisms in yeast and highlight how such mechanisms can complicate genome annotation efforts.

What methodological approaches are optimal for studying the frameshifting mechanism in YJR112W-A/YFS2?

To effectively study the frameshifting mechanism in YJR112W-A/YFS2, researchers should consider the following methodological approaches:

  • Ribosome profiling optimization:

    • Apply ribosome profiling with cycloheximide treatment to freeze ribosomes in place

    • Optimize RNase digestion to generate precise ~28-30 nucleotide protected fragments

    • Implement frame-specific read mapping to clearly identify transitions between reading frames

    • Calculate frameshifting efficiency by comparing ribosome density before and after the frameshifting site

  • Reporter assay systems:

    • Construct dual-luciferase reporters containing the YFS2 frameshifting sequence

    • Generate a series of mutant variants to identify critical nucleotides within and surrounding the heptamer

    • Design constructs with varying sequence context to test for potential regulatory elements

  • Comparative analysis with other frameshifting genes:

    • Create chimeric constructs swapping regions between YFS2 and other frameshifting genes (e.g., ABP140, YFS1)

    • Test frameshifting efficiency across different species to evaluate evolutionary conservation of mechanism

    • Analyze codon usage and tRNA abundance effects on frameshifting efficiency

  • Condition-dependent regulation:

    • Measure frameshifting efficiency under conditions where YFS2 deletion shows strong phenotypes

    • Analyze transcriptional and translational responses to environmental stresses

    • Identify potential regulatory factors through genetic screens

These approaches provide complementary data for understanding both the mechanistic basis and biological significance of frameshifting in YJR112W-A/YFS2.

How can researchers express and purify recombinant YJR112W-A/YFS2 protein for functional studies?

Expressing and purifying recombinant YJR112W-A/YFS2 protein presents unique challenges due to its frameshifting mechanism. Researchers should consider these methodological approaches:

  • Expression construct design strategies:

    • Native frameshifting approach: Maintain the natural frameshifting sequence to produce both frameshifted and non-frameshifted products, allowing study of their ratio and potential functional differences

    • Frame-corrected approach: Engineer a single reading frame by removing the frameshifting site, enabling production of only the complete protein

    • Separate domain expression: Express the pre-frameshift and post-frameshift portions separately to study domain-specific functions

  • Expression system selection:

    • S. cerevisiae expression: Maintains native cellular machinery for accurate frameshifting and proper folding

    • P. pastoris expression: Higher yield while maintaining yeast translational machinery

    • E. coli expression with codon optimization: For higher yield, though frameshifting efficiency may differ

  • Purification strategy:

    • Tandem affinity tags: Incorporate N-terminal and C-terminal tags to specifically isolate full-length frameshifted protein

    • Size-based separation: To distinguish between frameshifted and non-frameshifted products

    • Epitope accessibility considerations: Design tags with structural predictions to ensure accessibility

  • Validation approaches:

    • Mass spectrometry: To confirm the frameshifting junction sequence

    • N-terminal sequencing: To verify translation initiation site

    • Western blotting: With domain-specific antibodies to detect both protein versions

These methodological considerations enable researchers to produce properly folded, functionally active YJR112W-A/YFS2 protein for biochemical and structural studies, while accounting for the complexities introduced by the frameshifting mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.