Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL027W (YKL027W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TCD2; YKL027W; tRNA threonylcarbamoyladenosine dehydratase 2; t(6A37 dehydratase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
TCD2
Target Protein Sequence
MVEKDTWKLITATALFTVAVTTITDYAWTSWQAQKQVIAQQKNKNKGGQTKSDTDKYHQY DEQFIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKIRVVDFDQ VSLSSLNRHSCAILNDVGTPKVECLRRHMREIAPWCEIDPINELWTLQNGERLTLGNGTP DFIVDCIDNIDTKVDLLEFAYNHGIKVISSMGASAKSDPTKLNVGDLATTEEDPLARVVR RKLKKRGILSGIPVVFSAEKPDPKKAKLLPLPDEEYERGKVDELSALKDFRVRILPVLGT MPSLFGLTITTWILSNISDKPLEPVEGKNRIKVYDGIYQSLAGQMSRVGIPSQRIPLALK DVSYLVEEVFKGKSPISGISTRLTLTKWDPSKPISLQNVVVLTKNEQKVHEDRVLKGKES LQDVYDAKVLKLVSQRFREEAYYSQFR
Uniprot No.

Target Background

Function
This protein catalyzes the ATP-dependent dehydration of threonylcarbamoyladenosine at position 37 (t6A37) to form cyclic t6A37 (ct6A37) in tRNAs that recognize codons beginning with adenine.
Database Links

KEGG: sce:YKL027W

STRING: 4932.YKL027W

Protein Families
HesA/MoeB/ThiF family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What defines a protein as "uncharacterized" like YKL027W in Saccharomyces cerevisiae?

Uncharacterized proteins like YKL027W are predicted to be expressed from open reading frames (ORFs) identified during genome sequencing but lack experimental validation of their function. These proteins represent a substantial fraction of proteomes in both prokaryotes and eukaryotes. YKL027W specifically belongs to a category called "conserved hypothetical proteins" (CHPs) - proteins conserved among organisms from several phylogenetic lineages but without functional validation . Proper characterization requires multiple approaches, including computational prediction, protein-protein interaction studies, expression analysis, and structural determination to assign putative functions.

What preliminary bioinformatic analyses should be conducted when beginning research on YKL027W?

When initiating research on an uncharacterized protein like YKL027W, researchers should conduct a sequential bioinformatic workflow:

  • Sequence analysis through BLAST and multiple sequence alignments to identify homologs

  • Domain prediction using tools like Pfam, SMART, or InterPro

  • Secondary structure prediction via tools like PSIPRED

  • Protein-protein interaction prediction using STRING database

  • Subcellular localization prediction

  • Phylogenetic analysis to identify conserved regions across species

  • Protein structure prediction through homology modeling

This multi-tool approach provides initial hypotheses about potential functions that can guide experimental design for laboratory validation.

How can I distinguish YKL027W from other uncharacterized yeast proteins in experimental settings?

Distinguishing YKL027W from other uncharacterized yeast proteins requires a combination of approaches:

  • Recombinant expression with specific tags (His-tag, as mentioned in the available product)

  • Generation of specific antibodies against YKL027W

  • Mass spectrometry identification based on unique peptide fragments

  • Peptide mass fingerprinting technique, which creates a unique "mass fingerprint" specific to YKL027W

  • Use of tandem MS (MS-MS) approaches for greater identification specificity, especially important when working with complex proteomes

For yeast proteins like YKL027W, identification through peptide mass fingerprinting is highly successful, often requiring matching of only 3-4 peptides to confirm protein identity .

What are the key considerations for designing experiments to characterize YKL027W function?

When designing experiments to characterize YKL027W function, researchers should consider:

  • Broad sampling of biological variation with adequate replication

  • Inclusion of appropriate controls (wild-type strains, empty vector controls)

  • Use of multiple complementary approaches (genetic, biochemical, and cellular)

  • Selection of appropriate experimental conditions that might trigger expression

  • Analysis of phenotypic effects following gene knockout/knockdown

  • Analysis across different growth conditions and stress responses

How should I design gene knockout/knockdown experiments to study YKL027W function?

For effective gene knockout/knockdown studies of YKL027W:

  • Design precise CRISPR-Cas9 or homologous recombination strategies targeting YKL027W

  • Create both complete gene deletions and conditional knockdowns

  • Include marker genes for selection

  • Perform complementation studies with wild-type YKL027W to verify phenotypes

  • Monitor growth under various conditions (temperature, pH, carbon sources, stress conditions)

  • Compare transcriptome and proteome profiles between wild-type and knockout strains

  • Consider creating point mutations in conserved domains to identify critical residues

Remember that S. cerevisiae's genetic tractability makes it ideal for these approaches, but account for potential genetic background effects by testing in multiple strain backgrounds.

What are the most effective experimental controls when working with recombinant YKL027W protein?

Effective experimental controls when working with recombinant YKL027W include:

  • Empty vector controls processed identically to YKL027W-expressing constructs

  • Well-characterized proteins of similar size and properties expressed under identical conditions

  • Native (non-tagged) versions of the protein to assess tag interference

  • Heat-denatured YKL027W samples to distinguish between specific and non-specific effects

  • Dose-response experiments to confirm concentration-dependent effects

  • Time-course studies to determine temporal dynamics

"The types of biological inferences that can be drawn from experiments are fundamentally dependent on experimental design. The design must reflect the question being asked, the limitations of the experimental system, and the methods that will be used to analyze the data" .

Which chromatographic and electrophoretic techniques are most suitable for purifying recombinant YKL027W?

For optimal purification of recombinant YKL027W, multiple complementary techniques should be employed:

The combination of these techniques typically yields protein of >95% purity suitable for downstream functional and structural studies.

How should I optimize mass spectrometry protocols for analyzing YKL027W?

Optimizing mass spectrometry for YKL027W analysis requires:

  • Sample preparation: Use efficient digestion protocols (trypsin is commonly used) with proper reduction and alkylation

  • MALDI-MS selection: Matrix-assisted laser desorption ionization-mass spectrometry is particularly efficient for large-scale protein identification

  • Database matching: Create a comprehensive database including known S. cerevisiae proteins for accurate peptide mass mapping

  • Tandem MS approach: Implement MS-MS for greater identification specificity, especially important for complex samples

  • Peptide coverage: Aim for identification of at least 3-4 unique peptides, which is typically sufficient for yeast proteins

  • Quantitative analysis: Use stable isotope labeling or label-free quantification to assess expression levels

"Mass spectrometry is a powerful analytical technique for validating protein coding genes. It analyzes and quantifies thousands of proteins from complex samples and thus permits the characterisation of putative gene products at the level of translation" .

What advanced computational methods can help predict the function of YKL027W?

Advanced computational methods for predicting YKL027W function include:

  • Homology-based approaches that identify distant evolutionary relationships

  • Machine learning algorithms trained on characterized proteins

  • Network-based approaches analyzing protein-protein interaction data (STRING database)

  • Structural prediction using AlphaFold or RoseTTAFold to identify potential binding pockets

  • Molecular dynamics simulations to assess conformational dynamics

  • Integrated multi-omics approaches combining genomic, transcriptomic, and proteomic data

  • Text mining of scientific literature for potential functional relationships

These computational approaches should be considered complementary and used in combination for more robust predictions, as "development of computational approaches and programs on elucidation of the functions of CHPs create an opportunity for biologists to produce a complete record of their biological functions" .

What expression systems are most effective for producing recombinant YKL027W for structural studies?

For structural studies of YKL027W, several expression systems can be considered:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, simple culture, cost-effectiveMay lack proper post-translational modifications
Native S. cerevisiaeNatural post-translational modificationsLower yield than bacterial systems
Pichia pastorisHigh yield, proper protein folding, yeast PTMsLonger development time than E. coli
Insect cellsComplex eukaryotic PTMs, good for soluble proteinsMore expensive, technically demanding
Cell-free systemsRapid, avoids toxicity issuesLower yield, higher cost

The choice depends on research goals - E. coli systems may be sufficient for initial characterization, while eukaryotic systems might be necessary if post-translational modifications are critical to YKL027W function.

How can I optimize solubility and stability of recombinant YKL027W during purification?

To optimize YKL027W solubility and stability:

  • Test multiple fusion tags beyond His-tag (GST, MBP, SUMO) which can enhance solubility

  • Screen buffer compositions systematically (pH, salt concentration, additives)

  • Include stabilizing agents such as glycerol (5-10%)

  • Test detergents at concentrations below CMC if hydrophobic regions are present

  • Consider adding reducing agents if cysteine residues are present

  • Implement on-column refolding protocols if inclusion bodies form

  • Optimize temperature conditions during expression and purification

  • Use protease inhibitors to prevent degradation

During optimization, use small-scale expression tests and thermal shift assays to rapidly assess protein stability across different conditions before scaling up.

What approaches can address challenges in obtaining structural information for YKL027W?

Addressing structural challenges for YKL027W requires multiple complementary approaches:

  • X-ray crystallography: Focus on construct optimization by creating truncated versions based on domain predictions

  • Nuclear Magnetic Resonance (NMR): For smaller domains or full-length protein if <25 kDa

  • Cryo-electron microscopy: Particularly valuable if YKL027W forms larger complexes

  • Small-angle X-ray scattering (SAXS): For low-resolution structural information in solution

  • Hydrogen-deuterium exchange mass spectrometry: To probe conformational dynamics

  • Integrative structural biology: Combining multiple experimental approaches with computational modeling

  • AlphaFold predictions: As starting models to guide experimental design

"Development of computational approaches and programs on elucidation of the functions of CHPs create an opportunity for biologists to produce a complete record of their biological functions and the genes involved" .

How can I identify potential interaction partners of YKL027W?

To identify YKL027W interaction partners:

  • Yeast two-hybrid screening: Particularly appropriate as YKL027W is a native yeast protein

  • Affinity purification coupled with mass spectrometry (AP-MS): Using tagged YKL027W as bait

  • Proximity-dependent biotin identification (BioID): For transient interactions

  • Co-immunoprecipitation experiments: Using antibodies against YKL027W or its tags

  • Protein microarrays: To screen against large numbers of potential interactors

  • In silico prediction using resources like STRING database

  • Cross-linking mass spectrometry: To capture direct physical interactions

"Microarrays and protein expression profiles help understanding the biological systems through a systems-wide study of proteins and their interactions with other proteins and non-proteinaceous molecules to control complex processes in cells" .

What transcriptomic approaches can help understand YKL027W function?

For transcriptomic analysis related to YKL027W:

  • RNA-seq comparing wild-type and YKL027W knockout strains

  • Time-course expression analysis under various stress conditions

  • Co-expression network analysis to identify genes with similar expression patterns

  • Ribosome profiling to assess translation efficiency

  • Single-cell RNA-seq to detect cell-to-cell variability in expression response

  • Targeted validation using RT-qPCR for key differentially expressed genes

  • Integration with ChIP-seq data if YKL027W is suspected to have DNA-binding properties

How can phenotypic screens help elucidate the function of YKL027W?

Phenotypic screens for YKL027W function elucidation include:

  • Growth assays under various stress conditions (temperature, pH, oxidative stress)

  • Metabolic profiling to identify altered biochemical pathways

  • Cell morphology analysis using high-content imaging

  • Fitness profiling in competitive growth assays

  • Chemical genomics screening with diverse compound libraries

  • Synthetic genetic array (SGA) analysis to identify genetic interactions

  • Subcellular localization studies using fluorescently-tagged YKL027W

These approaches can provide valuable clues about YKL027W function, especially when S. cerevisiae knockout strains show subtle phenotypes under standard laboratory conditions.

How should I integrate multiple omics datasets to comprehensively characterize YKL027W?

For comprehensive multi-omics integration:

  • Implement a consistent experimental design across platforms

  • Normalize data appropriately for each omics type before integration

  • Use computational frameworks specifically designed for multi-omics integration (MOFA, mixOmics)

  • Apply network-based approaches to identify relationships across different data types

  • Employ dimensionality reduction techniques to visualize integrated datasets

  • Implement Bayesian approaches to handle uncertainty in different data types

  • Validate key findings using targeted experimental approaches

"Clearly, a carefully designed database containing toxicogenomic data along with other information would allow many of the unanswered questions about the applicability of genomic technologies to toxicology to be addressed" . This principle applies equally to functional characterization of uncharacterized proteins.

What statistical challenges might arise when analyzing YKL027W-related experimental data?

Statistical challenges in YKL027W data analysis include:

  • Multiple testing issues when analyzing high-throughput data

  • Batch effects across experimental runs

  • Missing data in certain experimental conditions

  • Integration of heterogeneous data types with different noise characteristics

  • Distinguishing biologically significant changes from technical variation

  • Appropriate power calculations for experimental design

  • Handling interdependencies among genes and their expression levels

As noted in the literature, "uncertainties about the variability inherent in the assays and in the study populations, as well as interdependencies among the genes and their levels of expression, limit the utility of power calculations" . These challenges require careful statistical approaches and validation strategies.

How can machine learning approaches help predict YKL027W function from diverse datasets?

Machine learning approaches for YKL027W function prediction:

  • Supervised learning using training sets of proteins with known functions

  • Unsupervised clustering to identify proteins with similar profiles

  • Deep learning models for integrating heterogeneous data types

  • Transfer learning from other well-characterized protein families

  • Ensemble methods combining multiple predictors for improved accuracy

  • Feature selection to identify the most informative characteristics for function prediction

  • Interpretable ML models that provide insights into the features driving predictions

These approaches are particularly valuable for integrating diverse data sources, from sequence features to expression patterns to interaction networks, providing a more holistic view of potential functions.

What is the potential significance of YKL027W in understanding S. cerevisiae biology?

The study of YKL027W may significantly impact our understanding of yeast biology by:

  • Filling knowledge gaps in fundamental cellular processes

  • Uncovering novel regulatory mechanisms in yeast cellular responses

  • Identifying new components of known pathways or complexes

  • Revealing unexpected functions in stress response or metabolic regulation

  • Providing insights into protein evolution and conservation

  • Contributing to the complete functional annotation of the yeast genome

  • Potentially revealing novel drug targets if the protein is essential

Research on conserved hypothetical proteins like YKL027W is crucial as "genome projects have led to the identification of many therapeutic targets, the putative function of the protein, and their interactions" .

How might understanding YKL027W contribute to biotechnological applications?

YKL027W research may contribute to biotechnology through:

  • Potential optimization of yeast strains for industrial applications

  • Development of new biosensors if YKL027W responds to specific conditions

  • Identification of novel enzymatic activities with industrial applications

  • Better understanding of yeast stress responses relevant to fermentation processes

  • New genetic tools based on YKL027W function

  • Insights into protein folding and stability relevant to recombinant protein production

  • Understanding of S. cerevisiae as a eukaryotic model for human disease genes

S. cerevisiae has been "instrumental in winemaking, baking, and brewing since ancient times" , and further functional characterization of its proteome enhances its utility in biotechnology.

What are the most promising future research directions for characterizing YKL027W?

Promising future research directions include:

  • CRISPR-based screens to identify synthetic lethal interactions

  • Development of small molecule modulators of YKL027W function

  • Cryo-EM studies of YKL027W in complex with interaction partners

  • Single-molecule approaches to study real-time dynamics

  • Comparative studies across different yeast species to understand evolutionary conservation

  • Integration with metabolomic profiling to identify affected biochemical pathways

  • Application of emerging proteomics technologies like thermal proteome profiling

"Next generation sequencing methods have accelerated multiple areas of genomics with special focus on uncharacterized proteins" , suggesting that continued technological advances will further facilitate YKL027W characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.