Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL047W (YKL047W)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Saccharomyces cerevisiae Uncharacterized protein YKL047W (YKL047W) is a protein derived from the yeast Saccharomyces cerevisiae . YKL047W is also known as ANR2 and AVL9-related family protein 2 .

Characteristics

CharacteristicDescription
SpeciesS. cerevisiae
SourceE. coli
TagHis-tagged
Protein LengthFull Length (1-516 amino acids)
FormLyophilized powder
Amino Acid SequenceMNSGGEEPTIKPNVFNITQLLNSNGEKPGIACIFLSKFDMKKGNIIIWSKSINGAAIDLSNIEFKSLPAGIHEQTDDVVNFVVPKELDVCQTAKTTTYDYGIAYFKQNSFDIIENDNRIDRSKVQMFSLGVIIDVQNASSDSKKHFYKEIYHAYAANRYSSYLESLLGQWIRQRDLDKFDIFEKFFDENNQGHMAENSVEVFEHSPKERRHLVEYLPYWTRKLGPLIFPLWKASLLQSRILILVPQGESFELCNSLAYCVFLISMLPKNLIGNHVSDEYIKPIFTVSTSDIPFLESFKKGNGYVATTSEEILLYKPEIYDIVVKLTSSSTIEESPEKEVEILTASGEQNKATPLDLEVYEKLI-LGELQEDASTNATCRHHEVTEPISWLQFLIDGFFLLTTAGYLVAPYHLANNFKIPRHVSGPEPNNSEIQIAENLVRYFHRRTSNLYNDLKDVIQKSENIDSEQPITIAASFLTKLNLDCFSKQDHQFVKDIALKWFQRSIDISNLPECLGNLC
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage is recommended .
Gene NameANR2
SynonymsANR2; YKL047W; YKL260; Uncharacterized protein ANR2; AVL9-related family protein 2
UniProt IDP36090

Function and Research

While YKL047W is currently annotated as an uncharacterized protein, research indicates potential roles and interactions within S. cerevisiae:

  • Response to Antimicrobial Peptides Chemical genomic screening suggests that genes including YKL047W are required for defense against antimicrobial peptides found in human saliva .

  • RIM101 Signaling Pathway Deletions in genes involved in the RIM101 signaling pathway, including YKL047W, result in fitness defects when treated with MUC7 peptide. The RIM101 pathway regulates the response to alkaline and neutral pH and other environmental conditions and appears to protect against stress imposed on yeasts .

  • Oral Vaccine Development S. cerevisiae can be utilized in oral vaccine formulations to deliver heterologous antigens safely and effectively . Recombinant S. cerevisiae expressing the capsid protein VP2 of IBDV can significantly increase specific IgG and sIgA antibody titers, suggesting its potential as an oral subunit vaccine .

  • Protein Complexes YKL047W may be part of various protein complexes within S. cerevisiae. Identification and curation of yeast protein complexes are crucial for understanding protein-protein interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ANR2; YKL047W; YKL260; Uncharacterized protein ANR2; AVL9-related family protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ANR2
Target Protein Sequence
MNSGGEEPTIKPNVFNITQLLNSNGEKPGIACIFLSKFDMKKGNIIIWSKSINGAAIDLS NIEFKSLPAGIHEQTDDVVNFVVPKELDVCQTAKTTTYDYGIAYFKQNSFDIIENDNRID RSKVQMFSLGVIIDVQNASSDSKKHFYKEIYHAYAANRYSSYLESLLGQWIRQRDLDKFD IFEKFFDENNQGHMAENSVEVFEHSPKERRHLVEYLPYWTRKLGPLIFPLWKASLLQSRI LILVPQGESFELCNSLAYCVFLISMLPKNLIGNHVSDEYIKPIFTVSTSDIPFLESFKKG NGYVATTSEEILLYKPEIYDIVVKLTSSSTIEESPEKEVEILTASGEQNKATPLDLEVYE KLILGELQEDASTNATCRHHEVTEPISWLQFLIDGFFLLTTAGYLVAPYHLANNFKIPRH VSGPEPNNSEIQIAENLVRYFHRRTSNLYNDLKDVIQKSENIDSEQPITIAASFLTKLNL DCFSKQDHQFVKDIALKWFQRSIDISNLPECLGNLC
Uniprot No.

Target Background

Function

May be involved in lipid metabolism.

Database Links

KEGG: sce:YKL047W

STRING: 4932.YKL047W

Subcellular Location
Lipid droplet.

Q&A

What is YKL047W and why is it significant for research?

YKL047W is an uncharacterized protein found in Saccharomyces cerevisiae (baker's yeast), a model organism widely used in molecular biology and genetics research. Hypothetical proteins (HPs) like YKL047W are predicted to be expressed from an open reading frame and constitute a substantial fraction of proteomes in both prokaryotes and eukaryotes . The significance of researching YKL047W lies in the broader impact of understanding the complete proteome of S. cerevisiae, which serves as an important model for eukaryotic cell biology. Additionally, characterizing previously unknown proteins often leads to discoveries of novel biological functions, potential disease associations, and new targets for therapeutics.

Methodologically, studying YKL047W contributes to filling gaps in our understanding of the yeast proteome and helps develop techniques that can be applied to other uncharacterized proteins across species. S. cerevisiae's importance as both a research organism and its occasional role as an opportunistic pathogen makes understanding its complete protein repertoire valuable for both basic and applied research .

What approaches are recommended for initial characterization of YKL047W?

Initial characterization of uncharacterized proteins like YKL047W should follow a systematic approach combining bioinformatic and experimental techniques:

  • Sequence analysis: Perform comparative sequence analysis using BLAST and other alignment tools to identify conserved domains and potential homologs in other species.

  • Structural prediction: Utilize computational methods to predict secondary and tertiary structures, which may provide insights into potential functions.

  • Expression profiling: Determine when and where the protein is expressed using techniques such as:

    • Two-dimensional gel electrophoresis (2-DGE) with immobilized pH gradients (IPGs)

    • Mass spectrometry (MS) for identification and characterization

    • RNA-seq to analyze transcription under various conditions

  • Subcellular localization: Use GFP-fusion proteins and immunofluorescence to determine where YKL047W localizes within the cell.

The most effective initial approach combines these methods, as described in protein characterization literature: "2-DE is routinely applied for separation and parallel quantitative expression profiling of large sets of complex protein mixtures such as whole cell lysates. 2-DE separates complex mixtures of proteins according to the differences in their isoelectric point" .

What is currently known about the genomic context of YKL047W?

While specific information about YKL047W is limited in the provided context, we can outline the methodological approach to understanding its genomic context:

The YKL047W designation indicates its chromosomal location in the S. cerevisiae genome, with "YKL" referring to its position on chromosome XI. Based on standard approaches to analyzing genomic context, researchers should examine:

  • Neighboring genes: Identify upstream and downstream genes that may be functionally related or co-regulated.

  • Promoter analysis: Examine the upstream regulatory regions for transcription factor binding sites and other regulatory elements.

  • Synteny analysis: Compare the genomic region containing YKL047W across related yeast species to identify conserved patterns that might suggest functional importance.

  • Transcriptional unit assessment: Determine whether YKL047W is part of an operon or independently transcribed.

Researchers investigating YKL047W should conduct comparative genomics analyses with other Saccharomyces species and related fungi to better understand its evolutionary context and potential function based on conserved genomic arrangements.

How can mass spectrometry be optimized for YKL047W characterization?

Mass spectrometry plays a crucial role in characterizing uncharacterized proteins like YKL047W. For optimal results, consider the following methodological approach:

  • Sample preparation optimization:

    • Cell culture and proper fractionation are critical first steps: "Identifying HPs starts with cell culture and sample fractionation, i.e., fair separation of protein mixture"

    • Enrich for low-abundance proteins, as uncharacterized proteins often have lower expression levels

    • Use multiple extraction methods to ensure comprehensive protein recovery

  • MS technique selection:

    • For initial identification: LC-MS/MS with high-resolution instruments

    • For post-translational modifications: Electron transfer dissociation (ETD) or electron capture dissociation (ECD)

    • For quantitative analysis: SILAC, iTRAQ, or TMT labeling to compare expression under different conditions

  • Data analysis workflow:

    • Use multiple search engines (MASCOT, SEQUEST, X!Tandem) to improve identification confidence

    • Apply stringent validation criteria to avoid false positives

    • Validate findings with targeted approaches like parallel reaction monitoring (PRM)

  • Integration with other technologies:

    • Combine MS data with other proteomics approaches like protein arrays

    • Use "lab-on-a-chip methods" which "rely on assays that are rapid and inexpensive"

MS ApproachApplication for YKL047WExpected Outcome
Bottom-up proteomicsProtein identification and sequence coverageConfirmation of expression and basic structural insights
Top-down proteomicsIntact protein analysisComplete protein characterization including PTMs
Native MSQuaternary structure analysisInformation about protein complexes involving YKL047W
Cross-linking MSProtein interaction mappingIdentification of binding partners and interaction sites

What protein-protein interaction methods are most suitable for studying YKL047W?

Understanding protein-protein interactions (PPIs) is crucial for elucidating the function of uncharacterized proteins like YKL047W. Several methodological approaches are recommended:

  • Yeast two-hybrid (Y2H) screening:

    • Particularly appropriate as YKL047W is a native yeast protein

    • Use both YKL047W as bait and as prey in comprehensive screens

    • Implement matrix-based approaches to test against the entire yeast proteome

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Tag YKL047W with affinity tags (FLAG, HA, or TAP tag)

    • Implement SILAC for quantitative interaction analysis

    • Use crosslinking to capture transient interactions

  • Proximity-based labeling methods:

    • BioID or APEX2 fusion proteins to identify proximal proteins

    • Time-resolved proximity labeling to detect dynamic interactions

  • Microfluidics approaches:

    • As noted in the research literature: "Microfluidics provides a powerful platform to study protein–protein interactions that play a major role in assigning the putative function to the HPs"

    • "Microfluidics large scale integration (mLSI) technology integrates 1000s of micromechanical values thus replacing conventional automatic methods of genomic and proteomic analysis and further enabling 100s of assays to be performed in parallel with multiple reagents"

  • Computational prediction and validation:

    • Use algorithms to predict potential interaction partners based on structural features

    • Validate computationally predicted interactions experimentally

Combining multiple methods provides the most comprehensive and reliable interaction network for YKL047W, which is essential for functional annotation.

How might YKL047W relate to pathogenicity in Saccharomyces cerevisiae?

The relationship between YKL047W and pathogenicity requires careful investigation, considering that S. cerevisiae is increasingly recognized as an opportunistic pathogen in immunocompromised individuals.

S. cerevisiae "should now be regarded as an opportunistic pathogen of low virulence rather than as a nonpathogenic yeast" . Research approaches to explore YKL047W's potential role in pathogenicity should include:

  • Comparative analysis of clinical vs. non-clinical isolates:

    • Examine YKL047W sequence variations between pathogenic and non-pathogenic strains

    • Compare expression levels between virulent and non-virulent isolates

    • "Clinical isolates of S. cerevisiae persisted in the brains of CD-1 mice for up to 7 days, but nonclinical isolates were cleared, indicating that pathogenic isolates can grow and avoid clearance in immunocompromized animals"

  • Virulence trait correlation studies:

    • Investigate whether YKL047W expression correlates with known virulence factors:

      • Pseudohyphal growth: "Virulent isolates may grow as pseudohyphae under certain conditions, and pseudohyphae have been seen to penetrate agar, which may give an indication of their role in vivo"

      • Flocculation: "Some clinical isolates have demonstrated the ability to flocculate under in vitro conditions, and this may constitute a virulence factor"

      • Heat-shock protein expression

  • Animal model studies:

    • Utilize established models: "Complement factor five-deficient mice were inoculated intravenously, and the presence of S. cerevisiae in the brain, spleen, liver, kidney, and lung was recorded"

    • Compare wild-type with YKL047W knockout strains in these models

  • Immune response analysis:

    • Examine how YKL047W affects host immune recognition and response

    • Study potential immunomodulatory properties

Understanding YKL047W's potential role in pathogenicity could provide insights into S. cerevisiae's transition from a generally harmless organism to an opportunistic pathogen in vulnerable populations.

What CRISPR-Cas9 strategies are optimal for functional analysis of YKL047W?

CRISPR-Cas9 technology provides powerful tools for functional analysis of uncharacterized proteins like YKL047W. A comprehensive CRISPR-based approach should include:

  • Gene knockout strategies:

    • Design multiple sgRNAs targeting different regions of YKL047W to ensure complete knockout

    • Use homology-directed repair (HDR) to replace YKL047W with selectable markers

    • Create conditional knockouts using inducible CRISPR systems for essential genes

  • Domain-specific mutations:

    • Implement CRISPR base editing to introduce point mutations in predicted functional domains

    • Use prime editing for precise sequence modifications without double-strand breaks

    • Create a series of truncation mutants to identify functional regions

  • Regulatory element analysis:

    • Target the promoter region of YKL047W to understand transcriptional regulation

    • Create reporter fusions to monitor expression under different conditions

  • High-throughput CRISPR screens:

    • Develop pooled CRISPR screens to identify genetic interactions with YKL047W

    • Implement CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) for modulating YKL047W expression

CRISPR StrategyExperimental PurposeExpected Outcome
Complete knockoutPhenotypic analysisUnderstanding essentiality and systemic effects
Domain mutationsStructure-function analysisIdentification of critical residues and domains
CRISPRi/CRISPRaExpression modulationEffects of varying expression levels
TaggingLocalization and interaction studiesSubcellular distribution and protein partners

After genetic modification, comprehensive phenotypic analysis should include growth assays, metabolomic profiling, stress response evaluation, and transcriptomic analysis to fully characterize the impact of YKL047W alterations.

How can systems biology approaches integrate YKL047W into protein networks?

Systems biology approaches are essential for placing uncharacterized proteins like YKL047W into functional contexts. A methodological framework for network integration includes:

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, metabolomics, and interactomics data

    • Use correlation networks to identify functional associations

    • Apply Bayesian networks to infer causal relationships

  • Network analysis methodologies:

    • Construct protein-protein interaction networks including YKL047W

    • Identify network modules and hubs associated with YKL047W

    • Apply topological analysis to predict functional importance

  • Perturbation studies:

    • Analyze network responses to YKL047W deletion or overexpression

    • Study differential network organization under various stress conditions

    • Implement time-course experiments to capture dynamic network changes

  • Computational modeling:

    • Develop mathematical models incorporating YKL047W into cellular pathways

    • Use flux balance analysis to predict metabolic impacts

    • Implement machine learning approaches to predict functional annotations

"A comprehensive identification of the HPs is needed for the functional interpretation of fully sequenced genomes and further understanding of the diverse functions of its unique structures, which in turn facilitates search for potential proteins of interest for researchers" .

Systems biology approaches should aim to generate testable hypotheses about YKL047W function that can be experimentally validated, creating an iterative cycle of prediction and verification.

What strategies are recommended for structural determination of YKL047W?

Determining the structure of uncharacterized proteins like YKL047W requires a multi-faceted approach:

  • Recombinant protein expression optimization:

    • Test multiple expression systems (E. coli, insect cells, yeast)

    • S. cerevisiae itself may be an ideal expression system: "S. cerevisiae is used to produce small hepatitis B surface proteins for use in hepatitis B vaccines, and production of the proteins is highest for those cells containing a high multicopy plasmid"

    • Optimize codon usage and add solubility tags if needed

    • Test different growth conditions and induction parameters

  • Protein purification strategies:

    • Implement multi-step purification protocols

    • Use affinity chromatography with engineered tags

    • Optimize buffer conditions for stability and homogeneity

  • Structural determination techniques:

    • X-ray crystallography: Focus on crystallization condition screening

    • Cryo-EM: Particularly useful if YKL047W forms complexes

    • NMR spectroscopy: For dynamic regions and smaller domains

    • Integrative structural biology: Combine multiple techniques

  • Computational structure prediction:

    • Use AlphaFold2 and RoseTTAFold for initial structural models

    • Validate computational models with experimental data

    • Apply molecular dynamics simulations to understand structural flexibility

For proteins that are difficult to express or purify, consider domain-based approaches, focusing on individual domains that may be more amenable to structural studies. Structure determination should be integrated with functional studies to correlate structural features with biological roles.

How can post-translational modifications of YKL047W be effectively characterized?

Post-translational modifications (PTMs) often play crucial roles in protein function and regulation. For YKL047W, a systematic approach to PTM characterization includes:

  • MS-based PTM identification strategies:

    • Enrichment techniques for specific PTMs:

      • Phosphorylation: TiO₂, IMAC, phospho-antibodies

      • Glycosylation: Lectin affinity, hydrazide chemistry

      • Ubiquitination: K-ε-GG antibodies, TUBEs

    • Multiple fragmentation methods: HCD, ETD, ECD for comprehensive coverage

    • Site-specific quantification using isotope labeling

  • Temporal dynamics of PTMs:

    • Time-course experiments following cellular perturbations

    • Pulse-chase labeling to track modification turnover

    • Correlation with cell cycle or stress response phases

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Creation of phosphomimetic mutants (S/T to E/D) or non-modifiable variants (S/T to A)

    • Analysis of PTM crosstalk and combinatorial effects

  • PTM-dependent interactions:

    • Identify PTM-dependent binding partners

    • Characterize reader domains that recognize modified YKL047W

    • Study how modifications affect protein localization and stability

PTM characterization should be performed under multiple physiological conditions and stress scenarios to capture the full range of modifications and their functional significance. This approach aligns with the understanding that "Development of computational approaches and programs on elucidation of the functions of CHPs create an opportunity for biologists to produce a complete record of their biological functions and the genes involved" .

How can contradictory experimental results regarding YKL047W be reconciled?

Contradictory results are common when studying uncharacterized proteins like YKL047W. A methodological approach to reconciliation includes:

  • Experimental design evaluation:

    • Conduct a thorough analysis of methodological differences between studies

    • Assess the sensitivity and specificity of different techniques

    • Evaluate the statistical power and reproducibility of each study

  • Context-dependent function assessment:

    • Examine cellular conditions across studies (growth phase, media composition, stress factors)

    • Consider genetic background differences between strains used

    • Evaluate potential moonlighting functions under different conditions

  • Integrative data analysis:

    • Apply meta-analysis techniques to combine data from multiple studies

    • Use Bayesian frameworks to incorporate prior knowledge with new evidence

    • Implement machine learning to identify patterns across disparate datasets

  • Targeted validation experiments:

    • Design experiments specifically to address contradictions

    • Use orthogonal techniques to validate key findings

    • Implement controlled condition matrices to systematically explore variables

  • Community standards and reporting:

    • Advocate for detailed methodology reporting

    • Establish minimum information standards for experiments on uncharacterized proteins

    • Create repositories for raw data to enable reanalysis

When contradictions arise, they often reveal important biological insights about condition-specific functions or regulatory mechanisms that should be systematically explored rather than dismissed.

What are the most promising approaches for integrating YKL047W into the broader functional landscape of yeast biology?

Integrating YKL047W into the functional landscape of yeast biology requires comprehensive data integration and contextual analysis:

  • Comparative genomics approaches:

    • Analyze YKL047W conservation across yeast species and other fungi

    • Identify co-evolving genes that may function in the same pathway

    • Study synteny patterns that suggest functional relationships

  • Global genetic interaction mapping:

    • Generate comprehensive genetic interaction profiles using SGA or CRISPR screens

    • Compare YKL047W genetic interaction signature with known genes

    • Apply clustering algorithms to position YKL047W in functional modules

  • Multi-dimensional data integration:

    • Implement tensor factorization and other advanced mathematical models

    • Use machine learning to identify patterns across heterogeneous datasets

    • Apply network diffusion algorithms to propagate functional annotations

  • Phenomic analysis:

    • Conduct high-throughput phenotypic profiling under hundreds of conditions

    • Use chemogenomic approaches to identify chemical-genetic interactions

    • Implement single-cell technologies to characterize phenotypic heterogeneity

This integrative approach aligns with the understanding that characterizing uncharacterized proteins requires diverse methods: "Development of computational approaches and programs on elucidation of the functions of CHPs create an opportunity for biologists to produce a complete record of their biological functions and the genes involved" .

What are the current limitations in YKL047W research and future directions?

Current limitations in YKL047W research reflect broader challenges in studying uncharacterized proteins, including:

  • Technical challenges:

    • Difficulties in expressing and purifying recombinant protein for structural studies

    • Limited antibody availability for native protein detection

    • Potential functional redundancy masking phenotypes in knockout studies

  • Knowledge gaps:

    • Incomplete understanding of protein-protein interaction networks

    • Limited information on condition-specific expression patterns

    • Uncertain evolutionary conservation and divergence patterns

  • Future research priorities:

    • Development of targeted resources specifically for YKL047W study

    • Integration of YKL047W into systems-level models of yeast biology

    • Investigation of potential roles in pathogenicity and stress response

  • Methodological advancements needed:

    • Advanced imaging techniques to track YKL047W in living cells

    • Improved computational prediction algorithms for uncharacterized proteins

    • Development of high-throughput functional screening approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.