Recombinant Saccharomyces cerevisiae Uncharacterized protein YMR187C (YMR187C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Uncharacterized Protein YMR187C (YMR187C)

Recombinant Saccharomyces cerevisiae Uncharacterized Protein YMR187C (YMR187C) is a protein derived from the yeast species Saccharomyces cerevisiae, commonly known as baker's yeast. This protein is identified by the UniProt ID Q03236 and is part of the yeast genome, specifically located at the YMR187C locus. Despite its designation as "uncharacterized," research into this protein involves its recombinant expression and study, often using Escherichia coli (E. coli) as the host organism for production.

Characteristics of Recombinant YMR187C Protein

The recombinant YMR187C protein is typically expressed in E. coli and is available as a full-length protein (1-431 amino acids) with an N-terminal His tag. This tagging facilitates purification and detection of the protein in various biochemical assays. Key characteristics of the recombinant YMR187C protein include:

CharacteristicDescription
SpeciesSaccharomyces cerevisiae
SourceEscherichia coli
TagN-terminal His tag
Protein LengthFull Length (1-431 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE

Antibodies for YMR187C

Antibodies specific to YMR187C are available for research purposes, such as the polyclonal antibody from Cusabio (Product Code CSB-PA311759XA01SVG). These antibodies are raised in rabbits using recombinant Saccharomyces cerevisiae YMR187C protein as the immunogen and are suitable for applications like ELISA and Western Blot .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YMR187C; YM8010.17C; Uncharacterized protein YMR187C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YMR187C
Target Protein Sequence
MTPPHFFLSLIKKRCICWICLEESTYDSTWLQHTCGCNLQIHKRCYIRWLYQMHVELFLP NTVDLPKDADLPIITCLKCLVDGHHDFMTTFSLTEIWETRPIWGQKSVPFQNDYVFNLMS LYTKRDNHPPYVLVKFGECPQCKKTNFIKRPTVTIQSSVLSLFYQWQKITRYVIPLGITS LFLLNPEKTSFDIGLWQLRCLFPENVLRNMLNISTTKALDVYAQTERGLLSIPLTSSIII YGFIHYLSNISNVSANAILFKWVYLSIVKTAGNKYYKGIGLPKIILYSNLATFCYNFTFK RLVDLIYRRLINKGGKYLYHGNFENSSNSVPAEEFFIRRNWYAILAEKILWPFVGKCTGG LLLNAFLWIQRKFKIEWTPNCSPSEFRMIFNIIGCGTAAIGWSSLKLYASYKRCQELEKI NEFIEQSCKGE
Uniprot No.

Target Background

Database Links

KEGG: sce:YMR187C

STRING: 4932.YMR187C

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.