Recombinant Saccharomyces cerevisiae Uncharacterized protein YPL168W (YPL168W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRX4; YPL168W; MIOREX complex component 4; Mitochondrial organization of gene expression protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MRX4
Target Protein Sequence
MTVLYTSASLKKMKCLAFNMGMNCVRTVSHARSGGAKFGGRNVFNIFDSKTPDSVRIKAF KNTIYQSAMGKGKTKFSAMEINLITSLVRGYKGEGKKNAINPLQTNVQILNKLLLTHRLT DKDILEGMNLAAGPVNVAIPRDITPQEEKKKVELRNRKAENMDLHPSRKMHIKELLHSLN LDMCNDEEVYQKISLYLQKNEESRTSVGASQQNHVDIDINSLKRYLQNIEKKARQKSAID KQKKNQARIYQWNTQSFSEIVPLSAGNILFKREPNRLWKRLQNGISVFLGSNGGGKKSKT TKKVLQGNNILLHSLENNKDMTLSNNFDHSVFNINFTDLFGVINASGSPPDRVLNEINEI ELKGWKCVGNLYDNNKIVVFQSSNPLLEDTKIPQKSFTNSKRFLISLSALLASFFAYYRY RLSQRQESKK
Uniprot No.

Target Background

Function
A component of MIOREX complexes; large expressome-like assemblies of ribosomes and factors involved in all post-transcriptional gene expression steps.
Database Links

KEGG: sce:YPL168W

Subcellular Location
Mitochondrion. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is YPL168W and how does it compare to other uncharacterized ORFs in S. cerevisiae?

YPL168W is an uncharacterized open reading frame (ORF) in Saccharomyces cerevisiae that encodes a hypothetical protein with unknown function. Similar to other uncharacterized ORFs like YLR162W, it represents one of the estimated 1000+ yeast genes with unclear biological roles. Studying such ORFs is crucial for completing our understanding of yeast cellular functions and identifying novel regulatory mechanisms. When approaching YPL168W research, consider that similar uncharacterized ORFs have been found to play roles in stress response, metabolism regulation, and cell cycle control when characterized through functional studies .

What expression patterns and regulation mechanisms have been observed for YPL168W?

While specific YPL168W expression data is limited, uncharacterized ORFs in yeast often show distinct expression patterns under specific environmental conditions. For example, YLR162W transcript levels are elevated under environmental stress, during α-factor response, and in stationary phase . To study YPL168W expression:

  • Perform northern blotting to detect transcript levels under various conditions

  • Use RT-qPCR for quantitative assessment of expression changes

  • Implement reporter constructs (e.g., YPL168W promoter fused to GFP) to monitor expression dynamics

  • Compare expression patterns across different growth phases and stress conditions

These approaches will help determine if YPL168W is regulated similarly to other stress-responsive genes or has unique expression characteristics.

What bioinformatic approaches should be used to predict YPL168W function?

When studying an uncharacterized protein like YPL168W, implement the following bioinformatic pipeline:

  • Sequence homology analysis: Compare amino acid sequence to characterized proteins using BLAST, HHpred, and PSI-BLAST

  • Domain prediction: Identify functional domains using SMART, Pfam, and InterPro databases

  • Structural prediction: Utilize AlphaFold2 and I-TASSER to generate 3D structural models

  • Phylogenetic analysis: Construct evolutionary trees to identify conserved features across species

  • Gene neighborhood analysis: Examine genomic context for functional associations

  • Co-expression network analysis: Identify genes with similar expression patterns

This comprehensive approach provides multiple lines of evidence for functional prediction rather than relying on a single method.

What are the best approaches for functional characterization of YPL168W?

Functional characterization of YPL168W should employ multiple complementary approaches:

  • Gene deletion and overexpression studies: Create YPL168W knockout strains and overexpression constructs to observe phenotypic changes under various conditions. This approach revealed that YLR162W overexpression inhibits cell proliferation and renders cells sensitive to hypoxia mimetic agents like CoCl₂ .

  • Cell cycle and viability analysis: Use flow cytometry to assess cell cycle progression and propidium iodide staining to evaluate cell viability. YLR162W overexpression showed inhibition of cell cycle progression with emergence of sub-G1 peak indicative of apoptosis .

  • Mitochondrial function assessment: Measure membrane potential (ψm) using fluorescent probes to detect potential roles in mitochondrial processes. YLR162W expression decreased mitochondrial membrane potential .

  • Stress response tests: Examine growth under various stressors (oxidative, reductive, osmotic) to identify condition-specific functions.

  • Protein-protein interaction studies: Implement affinity purification coupled with mass spectrometry (AP-MS) or yeast two-hybrid screening to identify interaction partners.

This multi-faceted approach will provide comprehensive insights into YPL168W function.

How can adaptive laboratory evolution techniques be applied to study YPL168W?

Adaptive laboratory evolution (ALE) offers powerful insights into gene function through selection for specific phenotypes:

  • Experimental design: Create parallel evolution lines using YPL168W deletion strains under selective pressure (e.g., nutrient limitation, stress conditions)

  • Monitoring methodology:

    • Measure specific growth rates after defined intervals (e.g., 5, 10, 23, 38, and 50 transfers)

    • Compare evolved populations to reference strains grown under standard conditions

    • Stop evolution when population reaches predetermined growth rate threshold (e.g., 90-95% of reference strain)

  • Strain isolation and characterization:

    • Isolate single colonies from evolved populations

    • Measure specific growth rates of isolates to confirm improved fitness

    • Sequence genomes to identify compensatory mutations

  • Reverse engineering:

    • Introduce identified mutations into parent strain using CRISPR/Cas9

    • Confirm phenotypic effects of individual mutations

This approach successfully identified mechanisms of vitamin prototrophy in S. cerevisiae and could reveal interaction networks involving YPL168W .

What techniques are most effective for studying YPL168W localization and dynamics?

To determine YPL168W subcellular localization and dynamics:

  • Fluorescent protein tagging:

    • C-terminal and N-terminal GFP fusions (considering potential interference with localization signals)

    • mNeonGreen or mScarlet tags for superior brightness and photostability

    • Verification of tagged protein functionality

  • Co-localization studies:

    • Use established organelle markers (Nup49-mCherry for nuclear envelope, Sec63-mCherry for ER)

    • Implement automated image analysis for quantitative co-localization assessment

  • Fluorescence microscopy approaches:

    • Confocal microscopy for high-resolution static imaging

    • Time-lapse fluorescence microscopy for protein dynamics

    • Super-resolution techniques (STED, PALM) for detailed localization

  • Biochemical fractionation:

    • Differential centrifugation for rough organelle separation

    • Density gradient separation for refined localization

    • Western blotting of fractions with YPL168W-specific antibodies

  • Inducible expression systems:

    • GAL1 promoter-controlled expression for temporal studies

    • Tetracycline-regulated systems for fine-tuned expression control

Combining these approaches provides robust evidence for protein localization and dynamics across different cellular conditions.

How should researchers interpret phenotypic changes in YPL168W overexpression or deletion strains?

When analyzing phenotypic changes in YPL168W modified strains, consider these methodological principles:

  • Distinguishing direct vs. indirect effects:

    • Implement acute vs. chronic expression systems

    • Use time-course experiments to identify primary responses

    • Compare early vs. late phenotypic changes

  • Control considerations:

    • Include empty vector controls for overexpression studies

    • Use isogenic wild-type strains for deletion comparisons

    • Implement overexpression of known proteins as functional controls

  • Quantitative assessment strategies:

    • Growth curve analysis with high temporal resolution

    • Colony size measurements for subtle fitness effects

    • Flow cytometry for cell cycle and morphology changes

    • Metabolomic profiling for biochemical alterations

  • Condition-dependent phenotyping:

    • Test multiple carbon sources and nutrient conditions

    • Examine responses to environmental stressors

    • Investigate cell cycle-specific effects

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis

    • Suppressor screens to identify functional partners

This structured approach prevents misinterpretation of phenotypic data and reveals condition-specific functions that might be overlooked in standard growth assays .

What are the key considerations for designing CRISPR/Cas9 experiments to study YPL168W?

When implementing CRISPR/Cas9 for YPL168W research:

  • Guide RNA design:

    • Select target sites with minimal off-target potential

    • Consider chromatin accessibility at potential target sites

    • Design multiple gRNAs to increase editing efficiency

    • Verify specificity using yeast genome databases

  • Repair template construction:

    • Include 40-60 bp homology arms for efficient homology-directed repair

    • Design silent mutations in PAM sites to prevent re-cutting

    • Include selection markers for efficient mutant isolation

    • Consider scarless editing approaches for minimal genomic disruption

  • Delivery methods:

    • Optimize transformation protocols for plasmid delivery

    • Consider ribonucleoprotein (RNP) delivery for transient expression

    • Implement inducible Cas9 expression for temporal control

  • Editing verification:

    • PCR-based genotyping for initial screening

    • Sanger sequencing for mutation confirmation

    • Whole-genome sequencing to detect off-target effects

    • Expression analysis to confirm expected transcript changes

  • Functional modifications:

    • Point mutations for structure-function analysis

    • Domain deletions for functional mapping

    • Regulatory element modifications to alter expression

    • Protein tagging for localization and interaction studies

This systematic approach ensures precise genetic manipulation for rigorous functional analysis of YPL168W .

How can researchers effectively study YPL168W under stress conditions?

To systematically investigate YPL168W function under stress:

  • Stress condition selection and optimization:

    • Environmental stressors (temperature, pH, osmotic pressure)

    • Chemical stressors (oxidative agents, heavy metals)

    • Nutrient limitations (carbon, nitrogen, phosphorus)

    • Hypoxic conditions using CoCl₂ or controlled oxygen atmosphere

  • Physiological response measurements:

    • Growth rate determination across stress gradients

    • Cell viability assessment using vital stains

    • Mitochondrial membrane potential using fluorescent probes

    • Reactive oxygen species (ROS) detection with specific indicators

  • Molecular response profiling:

    • Transcriptome analysis using RNA-seq

    • Proteome changes via mass spectrometry

    • Metabolite profiling to detect biochemical adaptations

    • Phosphoproteomics to identify signaling events

  • Time-resolved experiments:

    • Acute vs. chronic stress exposure protocols

    • Recovery dynamics following stress removal

    • Adaptation monitoring during prolonged stress

  • Integration with stress response pathways:

    • Epistasis analysis with known stress regulators

    • Reporter constructs for specific stress pathways

    • Checkpoint pathway analysis using deletion mutants

This comprehensive approach can reveal stress-specific functions similar to those observed for YLR162W, which showed growth inhibitory properties particularly under hypoxic conditions .

What statistical approaches are most appropriate for analyzing YPL168W experimental data?

When analyzing experimental data for YPL168W studies:

  • Growth curve analysis:

    • Calculate specific growth rates using log-linear regression

    • Apply non-linear models for complex growth dynamics

    • Implement bootstrap methods for confidence interval estimation

    • Use ANOVA with post-hoc tests for multiple condition comparisons

  • Flow cytometry data:

    • Apply appropriate gating strategies based on control samples

    • Use mixture modeling for subpopulation identification

    • Implement density-based clustering for heterogeneity analysis

    • Calculate statistical significance using Kolmogorov-Smirnov tests

  • Transcriptomic data:

    • Apply normalization methods appropriate for RNA-seq data

    • Use differential expression analysis with multiple testing correction

    • Implement gene set enrichment analysis for pathway identification

    • Apply multivariate approaches for pattern recognition

  • Time-series experiments:

    • Use repeated measures ANOVA for temporal comparisons

    • Apply time-series clustering for pattern identification

    • Implement state-space models for dynamic system analysis

    • Consider autocorrelation in statistical significance testing

  • Reproducibility considerations:

    • Report biological and technical replicates separately

    • Calculate appropriate effect sizes alongside p-values

    • Use power analysis for experimental design optimization

    • Implement bootstrapping for robust confidence interval estimation

These statistical approaches ensure rigorous data interpretation while addressing the complex dynamics often observed in yeast physiological studies .

How can researchers integrate multiple data types to develop comprehensive models of YPL168W function?

To develop integrative models of YPL168W function:

  • Multi-omics data integration approaches:

    • Correlation network analysis across omics layers

    • Pathway-based integration using known biological processes

    • Bayesian network modeling for causal relationship inference

    • Matrix factorization methods for pattern extraction

  • Computational modeling strategies:

    • Constraint-based metabolic modeling (if metabolic function is suspected)

    • Kinetic models for dynamic processes

    • Boolean networks for regulatory interactions

    • Agent-based models for cell population dynamics

  • Visualization techniques:

    • Interactive network visualizations for relationship exploration

    • Dimensionality reduction (PCA, t-SNE) for data overview

    • Heatmaps with hierarchical clustering for pattern identification

    • Volcano plots for significance and magnitude assessment

  • Knowledge-based integration:

    • Gene Ontology enrichment for functional annotation

    • Protein-protein interaction databases for context

    • Literature-based pathway analysis for biological interpretation

    • Comparative analysis with characterized homologs

  • Validation approaches:

    • Design targeted experiments to test model predictions

    • Implement cross-validation strategies for model assessment

    • Use independent datasets for external validation

    • Apply sensitivity analysis to identify key parameters

This integrative approach combines diverse experimental results into coherent functional models, similar to the comprehensive characterization achieved for other uncharacterized ORFs .

How might understanding YPL168W function contribute to fundamental yeast biology?

Understanding YPL168W function could advance fundamental yeast biology in several key areas:

  • Stress response mechanisms:

    • If YPL168W functions similarly to YLR162W, it may contribute to cellular adaptation during environmental stress

    • Could reveal novel stress signaling pathways not previously characterized

    • Might elucidate connections between stress response and cell cycle regulation

  • Cell cycle and growth control:

    • May identify new regulatory mechanisms for cell cycle progression

    • Could reveal condition-specific growth control systems

    • Might uncover connections between metabolic state and proliferation decisions

  • Evolutionary biology insights:

    • Analysis of conservation across species can reveal fundamental biological processes

    • Could identify yeast-specific adaptations for specialized niches

    • May reveal evolutionary patterns in gene regulation networks

  • Systems biology understanding:

    • Contribute to completing the functional map of the yeast genome

    • Help identify missing links in known biological pathways

    • Improve predictive models of cellular behavior under various conditions

  • Methodological advances:

    • Develop new approaches for characterizing uncharacterized proteins

    • Establish protocols for integrating multiple data types

    • Refine techniques for functional annotation of hypothetical proteins

Characterizing YPL168W would help complete our understanding of the yeast functional genome, contributing to the goal of understanding the roles of all yeast genes .

What are the challenges in translating findings from YPL168W studies to other uncharacterized proteins?

Researchers face several methodological challenges when translating findings from YPL168W to other uncharacterized proteins:

  • Functional context specificity:

    • Functions may be highly condition-dependent and not evident under standard laboratory conditions

    • Protein function might be redundant, requiring multiple gene deletions to observe phenotypes

    • Environmental or genetic background effects may influence functional outcomes

  • Technical limitations:

    • Low expression levels may hamper detection and characterization

    • Proteins may function in complexes, complicating individual analysis

    • Post-translational modifications might be critical but difficult to detect

    • Structural characteristics may limit applicability of standard methods

  • Validation complexities:

    • Confirming causal relationships between genotype and phenotype requires rigorous controls

    • Distinguishing primary from secondary effects demands careful experimental design

    • Consistent annotation standards are needed for meaningful comparisons

  • Interdisciplinary knowledge requirements:

    • Integration of computational predictions with experimental validation

    • Combining structural, genetic, and biochemical approaches

    • Implementing appropriate statistical methods for complex datasets

  • Strategic approaches to overcome challenges:

    • Develop standardized characterization pipelines for uncharacterized proteins

    • Implement machine learning approaches trained on characterized proteins

    • Create community resources for sharing methodologies and results

    • Establish consistent functional annotation standards

These challenges highlight the need for systematic, multi-faceted approaches to protein characterization that can be applied across different uncharacterized ORFs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.