Recombinant Saccharomyces cerevisiae Uncharacterized protein YPR063C (YPR063C)

Shipped with Ice Packs
In Stock

Description

Genetic Interactions and Phenotypic Observations

Genetic interaction studies provide insights into the functional roles of uncharacterized proteins. A global genetic interaction network for Saccharomyces cerevisiae identified both negative and positive genetic interactions involving YPR063C .

  • Negative Genetic Interactions Negative genetic interactions occur when combined mutations or deletions in separate genes result in a more severe fitness defect or lethality than either mutation alone . An example includes the interaction between ANP1 and YPR063C, where the combined deletion results in a significant fitness defect (SGA score = -0.1821, P-value = 0.03948) .

  • Phenotype One observed phenotype associated with YPR063C is colony size, suggesting its involvement in growth-related processes .

Role in Cellular Processes

Although YPR063C is largely uncharacterized, studies suggest potential involvement in essential cellular processes.

  • Protein Synthesis Chemical-genetic profile analysis has indicated that YPR063C may affect protein synthesis in yeast .

  • Translation Regulation Research indicates a possible role for YNR069C (another uncharacterized yeast protein) in the regulation of translation, particularly when translation is compromised .

  • Anaphase-Promoting Complex/Cyclosome (APC/C) Structural studies of S. cerevisiae APC/C have identified interactions with other APC/C subunits, such as APC13, indicating a role in cell cycle regulation .

Data Tables of Interactions

Gene 1Gene 2Interaction TypeSGA ScoreP-value
ANP1YPR063CNegative Genetic-0.18210.03948

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YPR063C; Uncharacterized protein YPR063C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPR063C
Target Protein Sequence
MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK GNTETTIETTTEVETETAKQ
Uniprot No.

Target Background

Database Links

KEGG: sce:YPR063C

STRING: 4932.YPR063C

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is YPR063C and why is it scientifically significant?

YPR063C is an uncharacterized protein encoded by the YPR063C gene in Saccharomyces cerevisiae (baker's yeast). It is also identified in UniProt as Q12160/YP063_YEAST . The protein represents part of a larger scientific challenge - despite the yeast genome being sequenced over a decade ago and being one of the most intensively studied model organisms, over 1,000 genes remain functionally uncharacterized .

YPR063C is scientifically significant because it exemplifies a fundamental paradox in modern molecular biology: despite having complete genome sequences and extensive genetic tools, we still lack functional understanding of many conserved genes. As noted in research literature, most uncharacterized yeast genes are likely authentic protein-coding sequences rather than annotation artifacts, as evidenced by their conservation in syntenic positions across related yeast species, suggesting evolutionary selection pressure for their retention . Understanding YPR063C's function could potentially reveal new biological pathways or cellular processes.

What is currently known about the structural features of YPR063C?

While YPR063C remains functionally uncharacterized, some structural information can be inferred from sequence analysis and bioinformatic predictions. According to available data, YPR063C, like many uncharacterized yeast genes, is likely to contain recognizable protein domains that may suggest specific metabolic or cellular activities . Approximately half of all uncharacterized yeast proteins contain recognizable protein domains cataloged in databases like Pfam .

How does YPR063C compare to other uncharacterized yeast proteins?

YPR063C is part of a substantial group of uncharacterized yeast proteins that, despite extensive genomic research, remain without clear functional annotation. Like many such proteins, it was evident from the initial genome sequence and has been present in databases for over a decade . YPR063C is likely among the majority (982) of uncharacterized genes present in the initial deletions consortium collection .

Most uncharacterized yeast proteins, potentially including YPR063C, appear in multiple genomics data sets, which may provide clues to function. These proteins are not necessarily obscure or atypical - they simply represent the challenging remainder of proteins whose functions are not immediately obvious from sequence homology or initial high-throughput screens. Current trends suggest that without targeted efforts, complete characterization of all yeast genes might not be achieved until approximately 2020 or later (from the perspective of the 2007 research) .

What experimental approaches are most effective for characterizing the function of YPR063C?

Effective characterization of YPR063C would likely benefit from a multi-faceted approach combining both traditional and high-throughput methodologies:

  • Gene deletion/mutation studies: Utilizing the available deletion consortium collection to analyze phenotypes resulting from YPR063C knockout under various conditions .

  • Domain-based functional prediction: For uncharacterized proteins with recognizable domains, developing assays that probe specific predicted activities. If YPR063C contains identifiable domains similar to protein kinases or RNA-binding proteins, specialized assays targeting these functions could be employed .

  • Cross-species conservation analysis: Examining syntenic conservation across related yeast species to infer functional importance and potential evolutionary constraints .

  • High-throughput interaction studies: Utilizing protein-protein interaction screens, genetic interaction mapping, and synthetic genetic array analysis to place YPR063C within cellular networks.

  • Conditional expression systems: Employing regulatable promoters to control YPR063C expression and observe resulting phenotypes.

A particularly promising approach mentioned in the literature is to have experienced researchers systematically evaluate uncharacterized genes like YPR063C along with their predicted attributes from sequence features or large-scale surveys . This human expertise can often bridge the gap between categorical predictions from high-throughput analyses and biological insight.

How can synthetic recombinant populations be utilized to study YPR063C function?

Synthetic recombinant populations represent a powerful approach for studying uncharacterized genes like YPR063C, especially for understanding complex genetic interactions and environmental responses. Two main strategies emerge from the research:

  • S-type population construction: This approach involves careful crossing designs where haploid strains are paired with different strains of opposite mating type, followed by manipulation of spores to achieve better representation of founder genotypes . For YPR063C studies, this would involve:

    • Pairing haploid strains carrying YPR063C variants with strains of opposite mating type

    • Allowing successful diploids to sporulate

    • Dissecting tetrads to collect meiotic products

    • Verifying proper segregation of markers

    • Creating cell banks of the recombinant population

  • Genome sequencing at defined intervals: After creating synthetic populations, genome sequencing at multiple timepoints (e.g., initial, after 6 cycles, after 12 cycles) allows researchers to track genetic variation and potential selection on YPR063C variants .

This approach is particularly valuable because it allows researchers to observe how YPR063C variants interact with other genetic backgrounds across multiple generations, potentially revealing functions that aren't apparent in conventional single-gene studies.

What methodologies can be used for expression and purification of recombinant YPR063C?

For biochemical and structural studies of YPR063C, researchers would need to express and purify the recombinant protein. A comprehensive methodology would include:

  • Cloning strategy selection:

    • Design primers to amplify the YPR063C coding sequence with appropriate restriction sites

    • Clone into suitable expression vectors containing affinity tags (His6, GST, MBP)

    • Consider codon optimization if expressing in non-yeast systems

  • Expression system selection:

    • Homologous expression in S. cerevisiae (advantages: native folding, post-translational modifications)

    • Heterologous expression in E. coli (advantages: high yield, simpler purification)

    • Expression in insect cells (advantages: eukaryotic processing, higher yield than yeast)

  • Purification protocol:

    • Initial capture: Affinity chromatography based on selected tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer optimization to maintain protein stability

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry to verify protein sequence

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to evaluate secondary structure

While no specific purification protocol for YPR063C appears in the provided search results, these approaches represent standard methodologies that would be applicable to this uncharacterized protein, with specific conditions requiring optimization based on the protein's properties.

How might YPR063C be involved in DNA replication or recombination processes?

Based on the search results discussing DNA replication and recombination in yeast, there are several hypothetical roles YPR063C might play in these processes that warrant investigation:

  • Potential role in origin selection or replication timing: The search results discuss the coordination of hundreds of replication forks distributed throughout the genome . YPR063C could potentially function in the selection of replication origins or regulation of replication timing, especially if it shows interactions with known replication factors.

  • Possible involvement in the intra-S phase checkpoint: Given the discussion of checkpoint mechanisms that coordinate DNA replication and recombination , YPR063C might function in signaling pathways that ensure genome stability during replication or that coordinate replication with other cellular processes.

  • Potential role in homologous recombination: The search results discuss mechanisms of homologous recombination and crossover formation . If YPR063C contains domains suggesting DNA binding or processing activities, it might function in these processes.

To investigate these possibilities, researchers could:

  • Analyze YPR063C localization during different cell cycle phases

  • Test genetic interactions between YPR063C and known replication/recombination genes

  • Examine replication timing and efficiency in YPR063C mutants

  • Assess DNA damage sensitivity and recombination rates in YPR063C mutants

What computational approaches can predict potential functions for YPR063C?

Advanced computational approaches can help predict potential functions for uncharacterized proteins like YPR063C:

  • Integrative data mining: Combining multiple genomic datasets (expression profiles, protein-protein interactions, genetic interactions, localization data) to predict function through guilt-by-association approaches. As noted in the literature, most uncharacterized genes appear in multiple genomics datasets that may provide clues to function .

  • Structural prediction and molecular modeling:

    • Employing tools like AlphaFold or RoseTTAFold for accurate protein structure prediction

    • Using molecular dynamics simulations to identify potential binding sites

    • Performing virtual screening for potential interacting molecules

  • Evolutionary analysis:

    • Examining syntenic conservation patterns across yeast species

    • Analyzing selection pressure on different regions of the protein

    • Identifying co-evolving residues that might indicate functional importance

  • Network-based prediction:

    • Constructing gene co-expression networks

    • Analyzing genetic interaction profiles

    • Identifying network neighbors with known functions

A concrete example from the literature mentions that systematic perusal of uncharacterized genes and their attributes from sequence features or large-scale surveys can help bridge the gap from computational predictions to biological insight . This suggests that computational approaches should be paired with expert knowledge to guide subsequent experimental verification.

How can researchers address the challenges in studying proteins with potential dual functions, like YPR063C?

Proteins with dual or context-dependent functions present unique challenges for characterization. Recent research suggests that some proteins, even potentially destructive ones, can have multiple roles depending on cellular conditions . While YPR063C isn't specifically mentioned in this context, the methodological approach to studying such proteins applies:

  • Condition-specific phenotypic analysis:

    • Test YPR063C deletion/overexpression under diverse environmental conditions

    • Examine effects during different cell cycle phases and developmental stages

    • Apply various stressors to uncover condition-specific functions

  • Temporal and spatial control of expression:

    • Employ tunable expression systems with tight temporal control

    • Use subcellular targeting sequences to restrict localization

    • Create chimeric proteins with domain-specific inactivation

  • Interactome mapping under different conditions:

    • Perform immunoprecipitation followed by mass spectrometry under different cellular states

    • Use proximity labeling approaches (BioID, APEX) to identify condition-specific interaction partners

    • Employ split-protein complementation assays to visualize interactions in living cells

  • Domain-specific functional analysis:

    • Create truncation constructs to test individual domain functions

    • Perform site-directed mutagenesis of key residues

    • Generate domain-swapped chimeras to test functional modularity

This comprehensive approach acknowledges that protein function can be highly context-dependent and that traditional single-condition analyses might miss important biological roles.

Experimental ApproachAdvantagesLimitationsAppropriate For
Gene deletionComprehensive phenotypic assessmentMay miss redundant functionsInitial characterization
Conditional expressionTemporal control of protein levelsPotential artifacts from expression systemLethal gene analysis
Domain predictionRapid functional hypothesis generationRequires experimental validationProteins with known domains
Synthetic genetic analysisReveals pathway relationshipsLabor intensiveNetwork positioning
Biochemical purificationDirect functional assessmentRequires protein stabilityEnzymatic activity testing

How should a research program be structured to systematically characterize YPR063C?

A comprehensive research program to characterize YPR063C would benefit from a structured, multi-phase approach:

  • Phase I: Bioinformatic characterization and hypothesis generation

    • Sequence analysis and domain prediction

    • Cross-species conservation analysis

    • Mining existing high-throughput datasets for YPR063C information

    • Generating testable hypotheses based on predicted domains or interaction partners

  • Phase II: Phenotypic characterization

    • Creating and validating deletion strains

    • Systematic phenotyping under diverse conditions

    • Identifying conditions where YPR063C becomes essential

    • High-throughput fitness profiling across chemical and environmental stresses

  • Phase III: Functional analysis

    • Subcellular localization studies

    • Protein-protein interaction mapping

    • Biochemical activity assays based on predicted domains

    • Genetic interaction mapping

  • Phase IV: Mechanistic studies

    • Structure determination (crystallography or cryo-EM)

    • In vitro reconstitution of activity

    • Identification of essential residues through mutagenesis

    • Integration of YPR063C into cellular pathways

This phased approach allows researchers to progressively build understanding while maintaining flexibility to redirect efforts based on emerging data. As noted in the literature, the characterization of uncharacterized yeast genes might be accelerated by having seasoned researchers systematically evaluate the list of uncharacterized genes and their attributes .

What are the common pitfalls in characterizing uncharacterized proteins like YPR063C?

Researchers working on uncharacterized proteins like YPR063C should be aware of several common pitfalls:

  • Over-reliance on single approaches: Depending solely on one experimental method may miss functions that are only apparent under specific conditions or through certain techniques. The literature suggests that many uncharacterized genes may have been attempted to be characterized without success using conventional approaches .

  • Confirmation bias in hypothesis testing: Forming early hypotheses about function based on weak evidence can lead to experimental designs that fail to test alternative functions.

  • Neglecting condition specificity: Many proteins only exhibit clear phenotypes under specific environmental conditions or developmental stages. The research literature notes that uncharacterized genes might be enriched for condition-specific functions .

  • Publication challenges: Research on uncharacterized proteins often faces higher publication barriers, as journals may prioritize studies on established genes. The literature suggests that systematic characterization efforts might be needed to overcome this challenge .

  • Incomplete validation of reagents: Ensuring the specificity of antibodies, correctness of gene deletions, and proper expression of tagged constructs is critical for reliable results.

To avoid these pitfalls, researchers should implement rigorous validation protocols, employ multiple complementary approaches, and remain open to unexpected findings that don't fit initial hypotheses.

How can new technologies accelerate the functional characterization of YPR063C?

Emerging technologies offer promising avenues to accelerate the characterization of uncharacterized proteins like YPR063C:

  • CRISPR-based functional genomics:

    • CRISPRi/CRISPRa for tunable gene repression or activation

    • Base editing for precise amino acid substitutions

    • CRISPR screens with focused libraries for pathway identification

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-state specific expression patterns

    • Single-cell proteomics to detect low-abundance proteins

    • Microfluidic approaches for high-throughput phenotyping

  • Advanced imaging techniques:

    • Live-cell super-resolution microscopy for precise localization

    • Multi-spectral imaging for co-localization studies

    • FRET/BRET sensors to detect protein interactions and conformational changes

  • Proteomics innovations:

    • Thermal proteome profiling to identify ligands and interactors

    • Cross-linking mass spectrometry for structural information

    • Targeted proteomics for quantification of low-abundance proteins

  • Structural biology approaches:

    • AlphaFold and other AI-based structure prediction tools

    • Cryo-EM for structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

These technologies, when applied systematically to YPR063C, could potentially overcome the limitations of conventional approaches that have left this protein uncharacterized despite decades of yeast research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.