Recombinant Saccharomyces cerevisiae Uncharacterized protein YPR153W (YPR153W)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
YPR153W; Uncharacterized protein YPR153W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPR153W
Target Protein Sequence
MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC AVVQILFDVVLSYSMVGSVM
Uniprot No.

Target Background

Database Links

KEGG: sce:YPR153W

STRING: 4932.YPR153W

Protein Families
TMEM170 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YPR153W and why is it significant for research?

YPR153W (also known as MAY24) is an uncharacterized protein in Saccharomyces cerevisiae with a length of 140 amino acids . It has gained research significance because despite being poorly characterized, it appears to play essential roles in yeast cellular function, particularly in pressure tolerance and possibly in other stress responses . The protein is increasingly recognized as important for fundamental cellular processes, making it a valuable target for basic research into eukaryotic cell biology using yeast as a model organism.

Why has YPR153W remained uncharacterized for so long?

YPR153W contains an intron that is inefficiently spliced, with a splicing rate of only 50% . This inefficient splicing likely contributed to it being overlooked in previous molecular and bioinformatic approaches. Additionally, the gene's function may not be immediately apparent under standard laboratory growth conditions, potentially requiring specific stressors like hydrostatic pressure to reveal its phenotype . This highlights the challenge of identifying and characterizing genes whose functions are context-dependent or stress-specific.

What cellular localization and basic function does YPR153W have?

While its precise cellular localization has not been definitively established in the provided search results, protein interaction data suggests functional relationships with mitochondrial proteins like COX14 (involved in cytochrome c oxidase assembly) and MAM33 (a mitochondrial matrix protein) . These interactions suggest a possible role in mitochondrial function. Functionally, it has been demonstrated that YPR153W is essential for the stability and proper transport function of Tat2, the high-affinity tryptophan permease, particularly under hydrostatic pressure conditions of 10-25 MPa .

How can researchers create and verify YPR153W deletion mutants?

To create YPR153W deletion mutants, researchers typically employ single-step gene disruption techniques using targeted homologous recombination. Similar to the method described for other yeast genes, researchers can design primers that amplify a disruption cassette (such as kanMX4 for G418 resistance), flanked by sequences homologous to regions upstream and downstream of the YPR153W open reading frame .

For verification of successful deletion, researchers should:

  • Perform PCR analysis using primers that bind outside the targeted integration site

  • Confirm the absence of YPR153W expression through RT-PCR

  • Verify the phenotype, particularly under pressure stress conditions (10-25 MPa)

  • Conduct complementation assays by transforming the deletion strain with a plasmid containing the wild-type YPR153W gene

What methods are used to assess the functional role of YPR153W in pressure tolerance?

Research into YPR153W's role in pressure tolerance employs several methodologies:

  • Growth assays under hydrostatic pressure: Comparing growth rates of wild-type and YPR153W deletion strains under varying pressures (0-25 MPa) in media that requires tryptophan uptake .

  • Protein stability analysis: Monitoring the degradation rate of Tat2 permease in wild-type versus deletion strains under pressure using techniques such as Western blotting with tagged Tat2 .

  • Complementation studies: Overexpressing TAT2 in the YPR153W deletion mutant to rescue growth under pressure, confirming the functional relationship between YPR153W and Tat2 stability .

  • Transport assays: Measuring tryptophan uptake rates under various pressure conditions to quantify the functional impact of YPR153W deletion on Tat2 permease activity .

How can researchers assess YPR153W splicing efficiency and its impact on expression?

To analyze the inefficient splicing of YPR153W (50% splicing rate) and understand its impact on expression:

  • RT-PCR analysis: Use primers flanking the intron to amplify both spliced and unspliced forms, followed by gel electrophoresis to quantify the ratio .

  • RNA-seq analysis: Perform deep sequencing of transcripts to precisely quantify spliced versus unspliced forms under various conditions .

  • Tiling arrays: High-density yeast-tiling arrays can be used to detect introns and alternative splicing events, as was done in the study that revealed the previously undiscovered intron in YPR153W .

  • Mutational analysis: Create variants with optimized splice sites to increase splicing efficiency and assess the impact on protein function and expression levels.

What protein interactions does YPR153W/MAY24 participate in?

According to protein interaction databases, YPR153W (MAY24) shows predicted functional partnerships with several proteins :

Interaction PartnerDescriptionConfidence Score
COX14Mitochondrial cytochrome c oxidase assembly factor0.960
UAF30Subunit of RNA polymerase I specific transcription factor0.935
MAM33Mitochondrial acidic protein, translational activator0.928
MTC4Maintenance of telomere capping protein0.691
MTC2Protein of unknown function0.684
ACT1Actin, structural protein for cytoskeletal functions0.610
DLT1Defect at low temperature protein0.564
RNQ1[PIN(+)] prion protein0.536

These interactions suggest potential roles in mitochondrial function, transcriptional regulation, and cellular stress responses .

How does YPR153W influence tryptophan permease stability under pressure?

YPR153W plays a critical role in maintaining the stability and functionality of Tat2, the high-affinity tryptophan permease, under hydrostatic pressure conditions. In YPR153W deletion mutants, Tat2 shows an increased rate of pressure-induced degradation compared to wild-type cells . The mechanism appears to involve:

  • Stabilization: YPR153W likely contributes to the structural stability of Tat2 under pressure, potentially through direct interaction or by influencing the membrane environment.

  • Degradation prevention: Without YPR153W, Tat2 is more rapidly degraded when cells are exposed to pressures of 10-25 MPa, suggesting a protective function.

  • Functional maintenance: YPR153W ensures that Tat2 maintains its transport capabilities under pressure, as evidenced by the fact that overexpression of TAT2 can overcome the growth defect of YPR153W mutants at 25 MPa .

The precise molecular mechanism of this stabilization remains to be fully elucidated but represents a specialized adaptation to pressure stress.

Is there evidence for YPR153W involvement in DNA damage response pathways?

While the search results don't provide direct evidence of YPR153W's role in DNA damage response, there is contextual information suggesting possible involvement. Search result discusses genome-wide screens for genes involved in UV- and MMS-induced DNA damage response, though it doesn't specifically highlight YPR153W as being identified in these screens. Additionally, YPR153W shows predicted functional interactions with MTC4 and MTC2 (Maintenance of Telomere Capping proteins) , which could potentially link it to telomere maintenance and genomic stability pathways.

To definitively establish YPR153W's role in DNA damage response, researchers should:

  • Assess sensitivity of YPR153W deletion mutants to various DNA damaging agents

  • Evaluate genetic interactions with known DNA repair pathway genes

  • Monitor DNA damage markers in YPR153W mutants

  • Analyze localization of the protein following DNA damage

How do evolutionary conservation and structural features of YPR153W inform its function?

Although the search results don't provide comprehensive information on YPR153W conservation or structure, an evolutionary approach to understanding this protein would involve:

  • Comparative genomics: Identifying homologs across fungal species and other eukaryotes to establish conservation patterns and potential functional domains.

  • Structural prediction: Using computational approaches to predict secondary and tertiary structures, potentially identifying functional motifs not obvious from sequence alone.

  • Evolutionary rate analysis: Determining whether YPR153W is under purifying selection (suggesting conserved function) or positive selection (indicating potential species-specific adaptations).

  • Functional complementation: Testing whether homologs from other species can rescue the YPR153W deletion phenotype, particularly under pressure stress conditions.

The protein's relatively small size (140 amino acids) suggests it might function as part of a larger complex or have a specialized regulatory role rather than possessing enzymatic activity.

What is the relationship between YPR153W's inefficient splicing and its function?

The inefficient splicing of YPR153W (50% splicing rate) raises intriguing questions about whether this represents a regulatory mechanism. Research approaches to address this question include:

  • Condition-dependent splicing analysis: Determining whether splicing efficiency changes under different environmental conditions, particularly pressure stress.

  • Functional comparison: Assessing the functional capabilities of proteins produced from spliced versus unspliced transcripts, if the unspliced transcript produces a protein.

  • Evolutionary conservation of inefficient splicing: Examining whether homologs in other yeast species show similar inefficient splicing, suggesting a conserved regulatory mechanism.

  • Regulatory network analysis: Identifying factors that influence YPR153W splicing efficiency and whether they connect to pressure response or tryptophan metabolism pathways.

This inefficient splicing may represent an evolutionary adaptation allowing for rapid modulation of protein levels in response to changing environmental conditions.

How might YPR153W function in a broader cellular stress response network?

Beyond its established role in pressure tolerance, YPR153W may participate in a broader cellular stress response network. Evidence supporting this includes:

  • Interaction with stress-related proteins: Predicted functional partnerships with DLT1 (Defect at Low Temperature protein, suggesting a role in cold stress) and potential connections to mitochondrial stress response through COX14 and MAM33 .

  • Connection to nutrient sensing: Its role in stabilizing Tat2, a tryptophan permease, suggests involvement in amino acid sensing and response pathways .

  • Potential telomere maintenance role: Predicted interactions with MTC2 and MTC4 (Maintenance of Telomere Capping proteins) could indicate involvement in genomic stability under stress .

To fully map YPR153W's position in stress response networks, researchers should perform transcriptomic and proteomic analyses of YPR153W mutants under various stress conditions, and conduct genetic interaction screens to identify synthetic lethal or sick interactions with known stress response genes.

How can systems biology approaches advance our understanding of YPR153W function?

Integrative systems biology approaches offer powerful ways to contextualize YPR153W function:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from YPR153W mutants under various conditions to identify affected pathways.

  • Network analysis: Mapping YPR153W within protein-protein interaction networks to identify modules and pathways it influences.

  • Flux analysis: Measuring changes in metabolic flux, particularly in tryptophan metabolism and related pathways, in YPR153W mutants.

  • Computational modeling: Developing predictive models of how YPR153W influences cellular responses to pressure and other stresses.

These approaches could reveal unexpected connections between YPR153W and cellular processes beyond its established role in pressure tolerance and tryptophan permease stability.

What technical challenges exist in studying YPR153W and how can they be overcome?

Several technical challenges complicate YPR153W research:

  • Inefficient splicing: The 50% splicing efficiency creates heterogeneous transcript populations, complicating expression analysis. This can be addressed through transcript-specific quantification methods and creation of intronless constructs for functional studies.

  • Pressure-dependent phenotypes: Studying pressure responses requires specialized equipment for culturing cells under controlled pressure conditions. Researchers should establish collaborations with labs possessing high-pressure cultivation systems.

  • Protein detection: As an uncharacterized protein, detection reagents may be limited. Developing epitope-tagged versions or generating specific antibodies will facilitate localization and interaction studies.

  • Functional redundancy: Potential redundancy with other genes may mask phenotypes in single deletion studies. This can be addressed through synthetic genetic array analysis and creating multiple deletion strains.

How might findings on YPR153W translate to applications in biotechnology and medicine?

While maintaining focus on academic rather than commercial applications, YPR153W research has potential translational implications:

  • Stress-resistant yeast strains: Understanding YPR153W's role in pressure tolerance could lead to engineered yeast strains with enhanced resistance to industrial process conditions.

  • Model for membrane protein stability: Insights into how YPR153W stabilizes Tat2 could inform approaches for stabilizing other membrane proteins, including therapeutically relevant human transporters.

  • Antifungal targets: If YPR153W homologs exist in pathogenic fungi, they might represent novel targets for antifungal development, particularly if the protein proves essential under physiologically relevant stress conditions.

  • Evolutionary insights: Understanding specialized adaptations to extreme conditions could reveal fundamental principles about how proteins evolve new functions, with broader implications for protein engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.