Recombinant Saccharomyces cerevisiae UPF0041 protein FMP37 (FMP37)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format preferences in your order notes. We will accommodate your request whenever possible.
Note: While we will prioritize shipping the format currently in stock, please specify any format preferences in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MPC1; FMP37; YGL080W; Mitochondrial pyruvate carrier 1; MPC1; Protein FMP37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MPC1
Target Protein Sequence
MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMT
FALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKE
WKEKEKTGKQ
Uniprot No.
Target Background
Function
This protein mediates the uptake of pyruvate into mitochondria.
Gene References Into Functions
- Mpc1 expression is independent of the carbon source, while Mpc2 and Mpc3 expression is specific to fermentative and respiratory conditions, respectively. This results in two alternative carrier complexes. PMID: 25672363
- Mpc1 (YGL080W) and Mpc2 (YHR162W) form a complex in the inner mitochondrial membrane. Loss of Mpc1 leads to impaired mitochondrial pyruvate uptake, demonstrating their essential role in the mitochondrial pyruvate carrier. PMID: 22628558
- The mitochondrial pyruvate carrier comprises Mpc1 (YGL080W) and either Mpc2 (YHR162W) or Mpc3 (YGR243W). These MPC proteins are located in the inner mitochondrial membrane; mutants lacking these proteins exhibit significant defects in mitochondrial pyruvate uptake. PMID: 22628554
Database Links
KEGG: sce:YGL080W
STRING: 4932.YGL080W
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion. Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
