Recombinant Saccharomyces cerevisiae UPF0136 membrane protein YJR085C (YJR085C)

Shipped with Ice Packs
In Stock

Description

Mitochondrial Membrane Organization

YJR085C interacts with MIC60 (YJR076C), a core component of the mitochondrial inner membrane organizing system (MINOS) . This complex maintains cristae junctions and influences mitochondrial morphology. In co-immunoprecipitation assays, YJR085C was identified as a binding partner of MIC60, hinting at a role in membrane scaffolding or protein biogenesis .

Genetic Interactions

YJR085C exhibits a negative genetic interaction with AGP2 (YBR132C), a plasma membrane polyamine transporter . Deletion of both genes exacerbates cellular fitness defects under stress, suggesting functional redundancy or compensatory pathways (Table 1).

Table 1: Genetic Interaction Profile of YJR085C

InteractorInteraction TypePhenotypeSGA ScoreP-value
AGP2Negative GeneticReduced colony size-0.17380.02998
MIC60Affinity Capture-MSMitochondrial organization

Role in Membrane Protein Biogenesis

While direct mechanistic data for YJR085C is limited, studies on homologous proteins suggest involvement in:

  • Chaperone-Mediated Folding: Cytosolic chaperones (e.g., Ydj1, Sis1) assist in the biogenesis of mitochondrial outer membrane (OM) proteins like Tom20 and Tom70 . YJR085C may require similar chaperone networks for stability or membrane integration.

  • Membrane Complex Assembly: Interaction with MIC60 implies participation in MINOS complex stability, which is critical for cristae formation and respiratory function .

Expression and Purification

Recombinant YJR085C has been produced using codon-optimized constructs and episomal plasmids in S. cerevisiae. Key steps include:

  • Promoter Systems: Inducible promoters (e.g., GAL1) enhance expression .

  • Purification: Affinity chromatography followed by proteolytic cleavage yields high-purity samples .

Unresolved Questions and Future Directions

  • Substrate Specificity: No enzymatic activity has been confirmed, though structural homology suggests potential lipid or protein-binding capabilities.

  • Regulatory Pathways: Its genetic link to AGP2 raises questions about cross-talk between mitochondrial and plasma membrane transport systems .

  • Disease Relevance: Orthologs in higher eukaryotes (e.g., human C19orf70) are linked to mitochondrial disorders, warranting further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please include a note with your order detailing your preference. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YJR085C; J1863; TMEM14 protein homolog YJR085C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YJR085C
Target Protein Sequence
MEHPAYTLSLLTTAGGLMGYYRKGSIPSLVSGLVFGSVYGIAGYLLHMNRDGGLEMALGA STLLLGAGVIRGMPSRFTKPVPVVLTALGGLGSYYYYNKYKEFYP
Uniprot No.

Target Background

Database Links

KEGG: sce:YJR085C

STRING: 4932.YJR085C

Protein Families
TMEM14 family
Subcellular Location
Mitochondrion. Membrane; Multi-pass membrane protein.

Q&A

What is YJR085C and what cellular components is it associated with?

YJR085C is classified as a UPF0136 membrane protein found in Saccharomyces cerevisiae (baker's yeast). According to the BioGRID database, this protein has defined Gene Ontology (GO) cellular component annotations, indicating its localization within specific cellular structures. While the specific cellular components are not fully detailed in the available data, the protein is characterized as a membrane protein, suggesting integration within cellular membrane structures . The UPF0136 designation indicates that it belongs to a family of uncharacterized protein family 0136, a classification used for proteins whose functions have not yet been fully determined through experimental validation.

What genetic interactions have been identified for YJR085C?

YJR085C has been identified in large-scale genetic interaction mapping studies, with a notable negative genetic interaction with ACE2 (SGA score = -0.3228, P-value = 6.053E-5). This interaction was identified in a comprehensive global genetic interaction network for Saccharomyces cerevisiae published in Science (2016), which constructed more than 23 million double mutants and identified approximately 550,000 negative and 350,000 positive genetic interactions . Negative genetic interactions, such as that between YJR085C and ACE2, occur when mutations or deletions in separate genes, each causing minimal phenotype individually, result in more severe fitness defects when combined in the same cell under specific conditions.

How does the YJR085C-ACE2 genetic interaction affect yeast phenotype?

The negative genetic interaction between YJR085C and ACE2 manifests in the phenotype of colony size reduction (APO:0000063). This phenotype was observed under high-throughput screening conditions and quantified with an SGA score of -0.3228 . For context, genetic interactions in this study were considered significant if they had a p-value < 0.05 and an SGA score < -0.12 for negative interactions (or > 0.16 for positive interactions). The YJR085C-ACE2 interaction exceeds this threshold, indicating a strong negative genetic relationship that substantially impacts cell growth and colony formation.

What expression systems are optimal for recombinant YJR085C production?

Recombinant UPF0136 membrane protein YJR085C can be expressed and purified from multiple host systems, with E. coli and yeast providing the highest yields and shortest turnaround times . For research requiring post-translational modifications crucial for correct protein folding or activity retention, expression systems using insect cells with baculovirus or mammalian cells are recommended . The choice of expression system should be guided by specific research requirements:

Expression SystemAdvantagesDisadvantagesApplications
E. coliHighest yields, rapid production, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
YeastGood yields, native environment, some PTMsModerate complexityFunctional studies in native context
Insect/BaculovirusBetter PTMs, eukaryotic processingLower yields, higher costStructure-function studies requiring PTMs
MammalianMost complete PTMs, authentic foldingLowest yields, highest cost, longest timeCritical activity studies

What are the methodological considerations for optimizing YJR085C purification?

Purification of membrane proteins like YJR085C requires specialized approaches due to their hydrophobic nature. The recommended methodology includes:

  • Cell lysis optimization: For yeast expression systems, standard procedures involve mechanical disruption using glass beads or enzymatic approaches with zymolyase followed by gentle lysis of spheroplasts.

  • Membrane fraction isolation: Differential centrifugation steps (typically 10,000g followed by 100,000g ultracentrifugation) to separate membrane fractions containing the target protein.

  • Detergent selection: Critical for solubilizing membrane proteins while maintaining protein stability and function. Common detergents for yeast membrane proteins include n-dodecyl β-D-maltoside (DDM), n-octyl β-D-glucopyranoside (OG), and digitonin.

  • Affinity purification: Utilizing fusion tags (such as His6, FLAG, or GST) for selective capture of the target protein. The choice of tag should consider potential interference with protein function.

  • Size exclusion chromatography: As a final polishing step to achieve high purity and remove aggregates or improperly folded protein species.

Each step requires optimization specific to YJR085C's properties to maximize yield while preserving structural integrity and function.

How can researchers experimentally validate the YJR085C-ACE2 genetic interaction?

To validate the reported negative genetic interaction between YJR085C and ACE2, researchers should consider the following methodological approach:

  • Generation of single and double mutants: Create yjr085c∆, ace2∆, and yjr085c∆ ace2∆ strains using standard yeast gene deletion techniques. The lithium acetate transformation procedure is typically used for yeast transformations, as referenced in methodologies for similar yeast genetic studies .

  • Phenotypic analysis: Quantitatively assess colony size and growth rates under various conditions using:

    • Spot dilution assays

    • Growth curve analysis in liquid media

    • Colony size measurements on solid media

  • Complementation studies: Reintroduce wild-type copies of either or both genes using expression plasmids to confirm that observed phenotypes are specifically due to the gene deletions.

  • Microscopic analysis: Evaluate cellular morphology and potential defects in cell separation, especially relevant since ACE2 is known to be involved in cell cycle regulation.

  • Quantification of genetic interaction: Calculate genetic interaction scores using methodologies similar to those described in the original study, where interactions were considered significant with p-values < 0.05 and SGA scores < -0.12 for negative interactions .

What genomic approaches can be used to identify additional genetic interactions of YJR085C?

To discover additional genetic interactions involving YJR085C, researchers can employ several comprehensive genomic approaches:

  • Synthetic Genetic Array (SGA) analysis: This approach, used in the study that identified the YJR085C-ACE2 interaction, systematically creates double mutants by crossing a query strain (yjr085c∆) with an array of deletion mutants covering the yeast genome . The resulting colonies are analyzed for growth defects to identify genetic interactions.

  • CRISPR-based screens: Utilizing CRISPR-Cas9 technology for generating combinatorial gene perturbations to identify genetic interactions with higher precision than traditional methods.

  • SCRaMbLE system application: The Synthetic Chromosome Rearrangement and Modification by LoxP-mediated Evolution (SCRaMbLE) system can be adapted to study genetic interactions by inducing genomic rearrangements in strains carrying YJR085C mutations. The methodology involves:

    • Culturing cells in appropriate selective media (e.g., SC-Ura)

    • Inducing SCRaMbLE with β-estradiol in galactose-containing media

    • Screening for phenotypic changes on selective media

    • Genotyping to identify specific genetic changes associated with observed phenotypes

  • Transcriptomic analysis: Comparing gene expression profiles between wild-type and yjr085c∆ strains using RNA-seq or microarray approaches similar to those described for other yeast studies, involving:

    • RNA isolation from synchronous cultures

    • cDNA library preparation

    • Hybridization to DNA microarrays containing appropriate probes

    • Differential expression analysis to identify functionally related genes

What methodologies are effective for determining the subcellular localization of YJR085C?

To accurately determine the subcellular localization of YJR085C, researchers should consider employing multiple complementary techniques:

  • Fluorescent protein tagging: Generation of YJR085C-GFP fusion constructs for direct visualization in living cells. This approach has been successfully used for tracking proteins during various cellular processes, including meiosis, as demonstrated with other yeast proteins like Php4 . The methodology involves:

    • C-terminal or N-terminal tagging of YJR085C with GFP

    • Expression from native promoter to maintain physiological levels

    • Confocal microscopy to visualize localization patterns

    • Co-localization studies with known organelle markers

  • Subcellular fractionation: Biochemical separation of cellular components followed by Western blot analysis to detect YJR085C in specific fractions:

    • Differential centrifugation to separate membrane fractions

    • Density gradient ultracentrifugation for further resolution

    • Immunoblotting with YJR085C-specific antibodies

  • Immunofluorescence microscopy: Using specific antibodies to detect fixed YJR085C in permeabilized cells:

    • Fixation with formaldehyde or methanol

    • Spheroplasting of yeast cell walls

    • Incubation with primary antibodies against YJR085C and fluorescent secondary antibodies

    • Visualization using epifluorescence or confocal microscopy

  • Electron microscopy with immunogold labeling: For high-resolution localization within membrane structures:

    • Ultra-thin sectioning of embedded yeast cells

    • Immunogold labeling with YJR085C-specific antibodies

    • Transmission electron microscopy imaging

How can researchers accurately assess membrane protein topology for YJR085C?

Determining the membrane topology of YJR085C (orientation of domains relative to the membrane) requires specialized techniques:

  • Protease protection assays: Treatment of intact cells, spheroplasts, or isolated membrane vesicles with proteases:

    • Domains exposed to the exterior will be degraded

    • Protected domains (opposite side of membrane) remain intact

    • Analysis by Western blotting with domain-specific antibodies

  • Site-directed fluorescence labeling:

    • Introduction of cysteine residues at predicted loop regions

    • Labeling with membrane-permeable or impermeable fluorescent dyes

    • Differential labeling indicates membrane orientation

  • Glycosylation site mapping:

    • Introduction of N-glycosylation sites at various positions

    • Analysis of glycosylation patterns (only occurs in ER lumen)

    • Determination of lumenal versus cytosolic domains

  • Computational prediction validation:

    • Use of algorithms (TMHMM, Phobius, TOPCONS) to predict topology

    • Experimental validation of key predictions using above methods

    • Iterative refinement of topology model

How can researchers investigate the potential role of YJR085C in DNA damage and repair processes?

Given the context of DNA repair mechanisms in yeast from the search results , researchers might explore potential connections between YJR085C and DNA repair processes using these methodologies:

  • DNA damage sensitivity assays:

    • Compare survival of wild-type and yjr085c∆ strains exposed to DNA damaging agents (UV, MMS, hydroxyurea, etc.)

    • Quantify colony formation efficiency after damage exposure

    • Measure growth curves in liquid media containing damaging agents

  • Analysis of genetic interactions with known DNA repair genes:

    • Generate double mutants of yjr085c∆ with deletions in key DNA repair genes

    • Assess synthetic lethality or fitness defects

    • Map YJR085C into existing DNA repair pathways based on interaction patterns

  • DNA repair kinetics assessment:

    • Introduce a site-specific DNA double-strand break (DSB) using systems like HO endonuclease

    • Monitor repair kinetics using Southern blotting or PCR-based assays

    • Compare repair efficiency between wild-type and yjr085c∆ strains

  • Chromatin immunoprecipitation (ChIP):

    • Determine if YJR085C associates with chromatin after DNA damage

    • Analyze recruitment kinetics to damaged DNA sites

    • Identify potential interaction partners at damage sites

  • Mutational analysis:

    • Assess mutation rates and spectra in yjr085c∆ strains using appropriate reporter systems

    • Determine if YJR085C affects specific repair pathways (homologous recombination, non-homologous end joining, etc.)

What experimental approaches can address contradictions in YJR085C functional data?

When researchers encounter contradictory findings regarding YJR085C function, these methodological approaches can help resolve discrepancies:

  • Conditional expression systems:

    • Use tetracycline-regulatable or galactose-inducible promoters to control YJR085C expression levels

    • Assess phenotypes under various expression conditions

    • Determine if contradictory findings relate to expression levels or timing

  • Allele-specific effects analysis:

    • Generate a series of point mutations or truncations in YJR085C

    • Assess functional consequences of each mutation

    • Determine if contradictions stem from allele-specific effects

  • Strain background comparison:

    • Test YJR085C function in multiple laboratory yeast strain backgrounds

    • Identify potential genetic modifiers influencing phenotypic outcomes

    • Standardize genetic backgrounds for comparative studies

  • Environmental condition matrix:

    • Systematically test YJR085C phenotypes across a matrix of environmental conditions

    • Identify condition-specific functions that might explain contradictory results

    • Develop standardized conditions for reproducible findings

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic analyses

    • Build integrated models of YJR085C function

    • Identify contextual factors influencing functional outcomes

What are the key considerations for designing gene knockout studies of YJR085C?

When designing gene knockout studies for YJR085C, researchers should consider these methodological aspects:

  • Knockout strategy selection:

    • Complete ORF deletion using selectable markers (URA3, KanMX, etc.)

    • Precise start-to-stop codon replacement to avoid affecting adjacent genes

    • Conditional systems for essential genes or those with severe growth defects

  • Transformation protocol optimization:

    • The standard lithium acetate transformation procedure is commonly used for yeast transformations

    • For potentially difficult transformations, electroporation or spheroplast transformation may yield higher efficiency

    • Include appropriate controls to verify transformation efficiency

  • Marker selection considerations:

    • Choose markers based on downstream applications (nutritional markers for complementation studies)

    • Consider marker swapping strategies for multiple genetic manipulations

    • Implement marker recycling systems (Cre-lox) for sequential modifications

  • Verification methodology:

    • PCR-based confirmation of correct integration

    • Sequencing of integration junctions

    • RNA-level verification (RT-PCR, RNase protection assays) to confirm absence of transcript

    • Protein-level confirmation via Western blotting

  • Phenotypic characterization planning:

    • Define comprehensive phenotypic assays based on predicted functions

    • Include broad screening approaches (growth in various media, stress conditions)

    • Develop quantitative metrics for phenotype assessment

What advanced techniques can improve reproducibility in YJR085C functional studies?

To enhance reproducibility in functional studies of YJR085C, researchers should implement:

  • CRISPR-based precision editing:

    • Generate clean, scarless mutations without selection markers

    • Create identical mutations across different strain backgrounds

    • Implement DNA repair template designs that minimize off-target effects

    • Consider the mutation rate and specificity of CRISPR-Cas9 systems when designing experiments

  • Standardized strain construction:

    • Develop a standardized genetic toolkit for YJR085C studies

    • Distribute identical reference strains among collaborating laboratories

    • Implement detailed documentation of strain construction history

  • Environmental parameter control:

    • Specify precise growth conditions with controlled:

      • Media composition (defined synthetic media)

      • Temperature control systems (±0.1°C precision)

      • Aeration rates and methods

      • Culture density standardization

      • Growth phase synchronization

  • Multi-laboratory validation protocols:

    • Design experiments with built-in reproducibility assessments

    • Implement blinded analysis where appropriate

    • Establish minimal reporting standards for methods sections

    • Share raw data and analysis pipelines

  • Quantitative phenotyping tools:

    • High-throughput growth analysis systems

    • Automated image analysis for morphological phenotypes

    • Standardized data processing algorithms

    • Statistical analysis protocols appropriate for the data type

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.