Recombinant Saccharomyces cerevisiae Vacuolar ATPase assembly integral membrane protein VPH2 (VPH2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
VPH2; CLS10; VMA12; YKL119C; YKL520; Vacuolar ATPase assembly integral membrane protein VPH2; Protein VMA12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
VPH2
Target Protein Sequence
MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV ADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL
Uniprot No.

Target Background

Function
Essential for vacuolar ATPase assembly.
Database Links

KEGG: sce:YKL119C

STRING: 4932.YKL119C

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of VPH2 in Saccharomyces cerevisiae V-ATPase assembly?

VPH2 functions as a critical assembly factor for the vacuolar H+-ATPase (V-ATPase) in Saccharomyces cerevisiae. Unlike structural components that form part of the final enzyme complex, VPH2 facilitates the proper folding and assembly of V-ATPase subunits in the endoplasmic reticulum. Research has demonstrated that VPH2, along with VMA21 and VMA22, acts as an assembly factor essential for the functional integration of V-ATPase subunits onto the vacuolar membrane . Deletion of the VPH2 gene results in cells that fail to assemble functional V-ATPases, leading to defects in vacuolar acidification and related cellular processes. This assembly role is distinct from the structural roles played by the V0 domain subunits (such as VMA6, VMA9) and V1 domain subunits (including VMA1, VMA5, VMA8, VMA10, VMA13) of the V-ATPase complex itself .

How can researchers generate recombinant VPH2 expression systems in Saccharomyces cerevisiae?

To generate recombinant VPH2 expression systems in S. cerevisiae, researchers typically follow a methodological approach similar to that used for other yeast proteins. The process involves:

  • PCR amplification of the VPH2 gene using specific primers that incorporate appropriate restriction sites

  • Cloning of the amplified gene into a suitable yeast expression vector containing a promoter (such as the constitutive GAPDH promoter)

  • Transformation of the recombinant plasmid into an appropriate S. cerevisiae strain

  • Selection of transformants using auxotrophic markers (e.g., leucine prototrophy in leu- strains)

  • Verification of correct integration and expression

For example, researchers could design primers to amplify the VPH2 gene and incorporate it into expression vectors similar to those used for other yeast proteins, as demonstrated in the approach for VP2 protein expression: "The individual transformants grown in SD-Leu auxotrophic medium were inoculated into 3 mL YPD medium and grown at 30 °C for 24 h with shaking 180 rpm. The extracted yeast genomic DNA was used as a template for PCR amplification analysis by the specific primer pair to confirm the correct recombination" . Expression can be confirmed through Western blotting using antibodies against a fusion tag (such as His-tag) incorporated into the recombinant protein construct .

What phenotypes are observed in vph2 deletion mutants of S. cerevisiae?

The deletion of VPH2 in S. cerevisiae results in several distinct phenotypic characteristics that directly reflect the critical role of V-ATPases in cellular physiology:

  • Failure to assemble functional V-ATPases, leading to defective vacuolar acidification

  • Sensitivity to elevated calcium levels in the growth medium

  • Inability to grow at neutral or alkaline pH (pH sensitivity)

  • Hypersensitivity to heavy metals and toxic compounds

  • Compromised vacuolar protein sorting and processing

  • Defects in endocytosis and membrane trafficking pathways

Particularly noteworthy is the observation that vph2 mutants may exhibit hypersensitivity to immunosuppressive compounds like cyclosporin A (CsA) and FK506, which inhibit calcineurin, a serine-threonine-specific phosphatase . The relationship between V-ATPase assembly and calcineurin activity reveals an intricate regulatory network where "a single nuclear mutation, designated cev1 for calcineurin essential for viability, is responsible for the CsA-FK506-sensitive phenotype" . This indicates that in the absence of properly assembled V-ATPases, cells become dependent on calcineurin activity for survival, highlighting the complex interplay between cellular pH regulation and calcium signaling pathways.

How can researchers quantify V-ATPase assembly efficiency in vph2 mutants compared to wild-type strains?

Quantifying V-ATPase assembly efficiency requires a multi-faceted approach combining biochemical, molecular, and imaging techniques:

  • Immunoblotting analysis: Comparing the levels of assembled V-ATPase complexes versus unassembled subunits between wild-type and vph2 mutant strains. This can be performed by isolating vacuolar membranes through differential centrifugation and analyzing the presence of V0 and V1 domain subunits using domain-specific antibodies.

  • Fluorescent probes for V-ATPase localization and quantification: Researchers can utilize specialized probes like SidK-derived fluorescent chimeras to visualize and quantify V-ATPases with high specificity. As described in recent methodological advances: "We introduce a new probe to localize and quantify V-ATPases. The probe is derived from SidK, a Legionella pneumophila effector protein that binds to the V-ATPase A subunit. We generated plasmids encoding fluorescent chimeras of SidK 1-278, and labeled recombinant SidK 1-278 with Alexa Fluor 568 to visualize and quantify V-ATPases with high specificity in live and fixed cells" .

  • Vacuolar pH measurement: Using pH-sensitive fluorescent dyes such as BCECF-AM or pHluorin to measure vacuolar acidification as a functional readout of V-ATPase assembly and activity.

  • Co-immunoprecipitation assays: To detect interactions between V-ATPase subunits and assembly factors during the assembly process.

  • Sucrose gradient centrifugation: To separate and quantify fully assembled V-ATPase complexes from partial assemblies and unassembled components.

By comparing these measurements between wild-type and vph2 mutant strains, researchers can precisely determine how VPH2 deficiency affects each stage of V-ATPase assembly, from initial subunit interaction to the formation of functional complexes at the vacuolar membrane.

What experimental designs are most appropriate for investigating VPH2's interaction with other V-ATPase assembly factors?

Investigating VPH2's interactions with other assembly factors requires carefully designed experiments that can detect both direct physical associations and functional relationships. The most appropriate experimental designs include:

  • Yeast two-hybrid (Y2H) analysis: To screen for direct protein-protein interactions between VPH2 and other assembly factors like VMA21 and VMA22, as well as with V-ATPase subunits.

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing protein interactions in vivo by fusing potential interacting partners with complementary fragments of a fluorescent protein.

  • Multi-element treatment designs: When comparing multiple experimental conditions simultaneously, such as different mutant combinations. As noted in methodological literature: "In a comparative analysis, you're comparing two different treatments, so you need an experimental design that can test more than one IV. So for a comparative analysis, you could use a multi-element treatment design or a multiple treatment reversal design"3.

  • Genetic interaction analysis: Creating double and triple mutants of vph2 with other assembly factor genes to identify synthetic lethal or suppressor relationships.

  • Conditional expression systems: Using inducible promoters to control the expression of VPH2 and other assembly factors to determine the temporal sequence of their actions during V-ATPase assembly.

Each of these experimental approaches provides complementary information that, when integrated, yields a comprehensive understanding of VPH2's role in the V-ATPase assembly network. For maximum validity, researchers should implement multiple methodologies and consider both component analysis (focusing on individual factors) and comparative analysis (examining relationships between factors)3.

How do mutations in VPH2 affect V-ATPase assembly compared to mutations in other assembly factors?

The impact of VPH2 mutations compared to other assembly factor mutations reveals distinct roles in the V-ATPase assembly pathway:

Assembly FactorPrimary FunctionMutant PhenotypeSubunit Assembly EffectLocalization
VPH2ER-resident assembly of V0 domainComplete V-ATPase assembly failurePrevents V0 domain assemblyER membrane
VMA21V0 domain assembly and transportComplete V-ATPase assembly failurePartial V0 assembly defectsER and transport vesicles
VMA22Co-chaperone for V0 assemblySevere assembly defectsUnstable V0 intermediatesER-associated

VPH2 mutations typically result in complete failure of V-ATPase assembly, similar to VMA21 mutations, while VMA22 mutations may allow limited assembly of defective complexes. This distinction reflects the sequential nature of the assembly process and the specific roles of each factor. Research indicates that "vph6 mutant strains fail to assemble the vacuolar H(+)-ATPase (V-ATPase)" , suggesting a fundamental role for these assembly factors.

The unique contribution of VPH2 appears to be early in the assembly pathway, with evidence suggesting it acts as a molecular scaffold in the endoplasmic reticulum to coordinate the initial steps of V0 domain assembly. Mutations in VPH2 prevent even the earliest detectable assembly intermediates from forming, whereas mutations in other factors may allow some intermediates to accumulate.

What is the relationship between VPH2 function and calcineurin signaling in S. cerevisiae?

The relationship between VPH2 function and calcineurin signaling represents a fascinating intersection of pH homeostasis and calcium signaling pathways in yeast. Research has revealed several key aspects of this relationship:

  • Compensatory mechanisms: In strains with defective V-ATPase assembly due to VPH2 mutations, calcineurin activity becomes essential for viability. This is evidenced by the finding that "a single nuclear mutation, designated cev1 for calcineurin essential for viability, is responsible for the CsA-FK506-sensitive phenotype" .

  • Calcium homeostasis: V-ATPase activity influences cytosolic Ca²⁺ levels by affecting vacuolar calcium sequestration. When VPH2 function is compromised, resulting in V-ATPase assembly defects, calcineurin activation appears to initiate alternative calcium homeostasis mechanisms.

  • Stress response integration: VPH2-dependent V-ATPase assembly and calcineurin signaling represent parallel pathways that can compensate for each other under certain stress conditions, particularly those affecting ion homeostasis.

  • Transcriptional regulation: Calcineurin regulates the expression of genes involved in ion homeostasis, which may provide alternative mechanisms for maintaining cellular pH and ion balance when V-ATPase function is compromised due to VPH2 deficiency.

This relationship underscores the complexity of cellular homeostasis mechanisms and suggests that calcineurin inhibitors like cyclosporin A and FK506 could serve as useful tools for investigating the consequences of V-ATPase assembly defects: "The peptidyl-prolyl cis-trans isomerases cyclophilin A and FKBP12, respectively, mediate CsA and FK506 toxicity in the cev1 mutant strain" .

What control strains should be included when studying VPH2 function in recombinant S. cerevisiae systems?

When designing experiments to study VPH2 function in recombinant systems, researchers should include the following control strains:

  • Wild-type strain: To establish baseline V-ATPase assembly and activity levels.

  • vph2Δ strain: Complete deletion mutant to demonstrate the full effect of VPH2 absence.

  • vph2Δ + VPH2 complementation strain: The deletion strain transformed with a plasmid expressing wild-type VPH2 to confirm that observed phenotypes are specifically due to VPH2 function.

  • Mutants of other V-ATPase assembly factors: Including vma21Δ and vma22Δ strains to distinguish VPH2-specific effects from general V-ATPase assembly defects.

  • V-ATPase structural subunit mutants: Such as vma6Δ or vma1Δ, to compare assembly factor defects with structural component defects.

  • Calcineurin pathway mutants: For studies investigating the relationship between VPH2 and calcineurin signaling, strains with mutations in components like CNB1 (calcineurin regulatory subunit) should be included.

  • Conditional expression strains: Where VPH2 expression can be induced or repressed to study dynamic aspects of assembly.

For instance, when studying interactions with calcineurin pathways, research has employed specific control strains: "We have characterized a Saccharomyces cerevisiae mutant strain that is hypersensitive to cyclosporin A (CsA) and FK506, immunosuppressants that inhibit calcineurin, a serine-threonine-specific phosphatase (PP2B)" .

How can researchers distinguish between primary and secondary effects of VPH2 mutations on cellular processes?

Distinguishing primary from secondary effects of VPH2 mutations requires a systematic approach combining temporal, genetic, and biochemical analyses:

  • Temporal analysis: Utilizing inducible expression systems to monitor the sequence of cellular changes following VPH2 inactivation. Primary effects will manifest earlier than secondary consequences.

  • Suppressor screens: Identifying mutations that can suppress specific phenotypes of vph2Δ strains but not others, helping to delineate separate pathways affected by VPH2 loss.

  • Pathway-specific reporters: Implementing fluorescent or enzymatic reporters for different cellular processes (e.g., vacuolar acidification, protein trafficking, metal homeostasis) to monitor their disruption timing and severity.

  • Epistasis analysis: Creating double mutants of vph2Δ with mutations in genes involved in related processes to determine their functional hierarchy.

  • Comparative analysis across V-ATPase assembly mutants: As shown in Table 5 from the research literature, comparing phenotypes between different V-ATPase assembly mutants can reveal process-specific versus general effects:

Cellular function and gene(s)DescriptionRelation to VPH2
Vacuolar acidification (VMA6, VMA9)V0 domain subunitsDirect assembly targets of VPH2
VMA1, VMA5, VMA8, VMA10, VMA13V1 domain subunitsIndirectly affected by VPH2
VMA21, VMA22V-ATPase assembly factorsCo-factors with VPH2
VPS16, CHC1Protein traffickingSecondary processes disrupted by VPH2 loss
AFT1, ZAP1Metal homeostasisTertiary effects of pH disruption

This comprehensive approach allows researchers to construct a hierarchical model of cellular processes affected by VPH2 dysfunction, distinguishing its direct role in V-ATPase assembly from downstream consequences on cell physiology .

What methodological approaches can overcome technical challenges in expressing and purifying functional recombinant VPH2?

Expression and purification of functional VPH2 present significant technical challenges due to its integral membrane nature and involvement in complex assembly processes. Researchers can employ these methodological approaches to overcome these challenges:

  • Optimized expression systems:

    • Use of specialized yeast strains designed for membrane protein expression

    • Implementation of inducible promoters like GAL1 to control expression levels

    • Codon optimization of the VPH2 sequence for enhanced translation efficiency

  • Fusion protein strategies:

    • N- or C-terminal fusion with solubility-enhancing partners (e.g., MBP, SUMO)

    • Addition of purification tags that minimally impact function (e.g., His6, FLAG)

    • Incorporation of fluorescent protein fusions for localization studies

  • Membrane protein solubilization and purification:

    • Screening of multiple detergents to identify optimal solubilization conditions

    • Use of amphipols or nanodiscs to maintain protein stability after extraction

    • Employment of native-like phospholipid environments during purification

  • Co-expression approaches:

    • Simultaneous expression of VPH2 with interacting partners (VMA21, VMA22)

    • Co-expression with stabilizing V-ATPase subunits

  • Functional verification methods:

    • Development of in vitro assembly assays using purified V-ATPase components

    • Complementation assays in vph2Δ strains to verify functionality of recombinant constructs

Researchers have successfully employed similar approaches for other challenging yeast proteins: "The expression of recombinant VP2 in yeast was detected via Western blotting. After cultivation of the recombinant yeast in YPD liquid medium at 30 °C, yeast cells were harvested and lysed to gain the supernatant, which was performed for SDS-PAGE (12%) and Western Blot" . Additionally, localization studies can be performed using techniques like immunofluorescence assays, where "yeast cells were treated with 4% paraformaldehyde for 15 min and following incubation of rabbit anti-His-tag antibody overnight at 4 °C. The FITC-conjugated anti-rabbit IgG was incubated for an additional 1 h" .

How does the understanding of VPH2 in yeast translate to V-ATPase assembly in higher eukaryotes?

The conservation and divergence of VPH2-mediated V-ATPase assembly mechanisms between yeast and higher eukaryotes represents an important area of comparative biology with implications for human disease research:

This translational approach leverages the genetic tractability of yeast to gain insights into the more complex assembly processes of multicellular organisms, potentially revealing conserved targets for therapeutic intervention in V-ATPase-related disorders.

What are the most promising techniques for real-time monitoring of VPH2-mediated V-ATPase assembly in living cells?

Cutting-edge techniques for real-time monitoring of VPH2-mediated V-ATPase assembly include:

  • Advanced fluorescent protein approaches:

    • Split fluorescent protein complementation to visualize VPH2 interactions with assembly partners

    • FRET-based biosensors to detect conformational changes during assembly

    • Photoconvertible fluorescent protein fusions to track assembly factor dynamics

  • Live-cell super-resolution microscopy:

    • Structured illumination microscopy (SIM) for enhanced spatial resolution of assembly sites

    • Single-molecule localization microscopy to track individual assembly events

    • Lattice light-sheet microscopy for extended 3D imaging with reduced phototoxicity

  • Specialized probes for V-ATPase visualization:

    • Adapting the SidK-based probe system for dual-color imaging with VPH2: "We generated plasmids encoding fluorescent chimeras of SidK 1-278, and labeled recombinant SidK 1-278 with Alexa Fluor 568 to visualize and quantify V-ATPases with high specificity in live and fixed cells"

    • pH-sensitive fluorescent proteins targeted to assembly compartments

  • Optogenetic approaches:

    • Light-inducible control of VPH2 expression or localization

    • Photocaging techniques to activate VPH2 function with spatial and temporal precision

  • Correlative light and electron microscopy (CLEM):

    • Combining fluorescence imaging of assembly dynamics with high-resolution EM visualization of structural details

These approaches enable researchers to observe the spatial and temporal dynamics of V-ATPase assembly as mediated by VPH2, providing unprecedented insights into this complex process. The ability to monitor assembly in real-time is particularly valuable for understanding the sequential recruitment of components and the coordination between different assembly factors.

What experimental approaches can identify novel functional interactions between VPH2 and cellular stress response pathways?

Identifying novel functional interactions between VPH2 and stress response pathways requires multifaceted experimental strategies:

  • Genomic approaches:

    • Synthetic genetic array (SGA) analysis to identify genetic interactions between VPH2 and stress response genes

    • CRISPR-based screens in VPH2-deficient backgrounds to identify synthetic lethal or suppressor relationships

    • Transcriptome analysis comparing gene expression patterns between wild-type and vph2Δ strains under various stress conditions

  • Proteomic strategies:

    • Proximity-dependent biotin identification (BioID) or APEX2 to identify proteins in the vicinity of VPH2 during stress

    • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify changes in protein interactions following stress exposure

    • Global protein phosphorylation analysis to identify stress-responsive signaling pathways affected by VPH2 loss

  • Functional assays:

    • Systematic phenotypic analysis of vph2Δ strains under different stress conditions (oxidative, osmotic, heat, nutrient limitation)

    • Chemical-genetic profiling using libraries of stress-inducing compounds

    • Measurement of stress response pathway activation using reporter constructs

  • Metabolomic analysis:

    • Quantification of changes in key metabolites associated with stress responses

    • Analysis of energy metabolism parameters under stress conditions

Research has already identified connections between V-ATPase assembly and stress pathways: "vph6 mutants may exhibit hypersensitivity to immunosuppressive compounds like cyclosporin A (CsA) and FK506, which inhibit calcineurin" . Additionally, connections to metal homeostasis have been observed, with V-ATPase-related genes functionally linked to "AFT1 (Iron-responsive transcription factor)" and "ZAP1 (Zinc-activated protein)" .

These comprehensive approaches can reveal how VPH2-mediated V-ATPase assembly is integrated with cellular stress response networks, providing insights into adaptation mechanisms and potential therapeutic targets.

How does VPH2 research contribute to our understanding of organelle biogenesis and membrane protein assembly?

VPH2 research provides fundamental insights into organelle biogenesis and membrane protein assembly pathways that extend beyond V-ATPase biology:

  • Model for multi-subunit membrane complex assembly: The VPH2-mediated V-ATPase assembly process serves as a paradigm for understanding how complex membrane-bound molecular machines are constructed in eukaryotic cells. It illustrates principles of sequential assembly, quality control, and the role of dedicated assembly factors.

  • Compartment-specific assembly mechanisms: Studies of VPH2 reveal how the endoplasmic reticulum serves as an assembly platform for complexes destined for other organelles, highlighting the interconnected nature of the endomembrane system and organelle identity establishment.

  • Integration of assembly and trafficking pathways: The coordination between VPH2-mediated assembly and subsequent transport of V-ATPase complexes to the vacuole demonstrates how protein biogenesis and membrane trafficking pathways are functionally linked.

  • Evolutionary conservation of assembly mechanisms: Comparison of yeast VPH2 with homologs in other organisms provides insights into the evolution of organelle biogenesis pathways and identifies core mechanisms conserved throughout eukaryotic lineages.

  • Cell biological principles of protein quality control: VPH2 research reveals how cells ensure that only properly assembled complexes reach their final destination, preventing potentially harmful accumulation of incomplete assemblies.

These contributions extend the significance of VPH2 research beyond its specific role in V-ATPase biology, establishing it as a valuable model system for understanding fundamental cellular processes relevant to numerous biological contexts and disease states.

What are the implications of VPH2 research for understanding and treating human diseases related to V-ATPase dysfunction?

VPH2 research in yeast provides valuable insights with significant implications for human V-ATPase-related diseases:

  • Identification of therapeutic targets: Understanding the precise mechanisms of V-ATPase assembly through VPH2 studies reveals potential intervention points for diseases characterized by V-ATPase dysfunction. These may include cancers where V-ATPases contribute to tumor acidification and drug resistance, or osteopetrosis caused by V-ATPase defects in osteoclasts.

  • Development of specific V-ATPase modulators: Insights from VPH2-mediated assembly mechanisms can guide the development of compounds that modulate V-ATPase activity in a tissue-specific or context-dependent manner, potentially reducing side effects associated with global V-ATPase inhibition.

  • Improved disease models: The detailed understanding of V-ATPase assembly from yeast studies enables the creation of more precise disease models in higher organisms, facilitating the study of pathogenic mechanisms and therapeutic testing.

  • Diagnostic applications: Knowledge of assembly defects may lead to new diagnostic approaches for V-ATPase-related disorders through the identification of specific biomarkers associated with assembly dysfunction.

  • Personalized medicine approaches: Understanding the molecular consequences of specific mutations in V-ATPase assembly pathways can inform individualized treatment strategies for patients with genetic disorders affecting V-ATPase function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.