Recombinant Saccharomyces cerevisiae Vacuolar integral membrane protein YDR352W (YDR352W)

Shipped with Ice Packs
In Stock

Description

Protein Structure

YDR352W is a full-length integral membrane protein (317 amino acids) with seven transmembrane domains, characteristic of the PQ-loop family . Its amino acid sequence begins with MSCSNGIWPTVSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSLI and extends to AQLVTERTSLLSGETQT . Key structural features include:

  • Tag: N-terminal His-tag for purification and detection .

  • Molecular Weight: Not explicitly stated, but inferred from full-length recombinant production.

Functional Role

YDR352W is implicated in:

  • Cationic Amino Acid Transport: Likely exports cationic amino acids (e.g., arginine, lysine) from the vacuole, maintaining intracellular amino acid balance .

  • Functional Complementation: Mutant phenotypes are rescued by rat PQLC2, suggesting conserved transport mechanisms across species .

  • Pathway Involvement: While specific pathways are not detailed in available sources, PQ-loop proteins often participate in nutrient trafficking and organelle function .

Recombinant Production

YDR352W is expressed in E. coli and purified via affinity chromatography. Key parameters include:

ParameterValue
HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Applications

  • SDS-PAGE: Used to assess purity and confirm molecular weight .

  • ELISA/Western Blot: Detectable using rabbit polyclonal antibodies (e.g., anti-YPQ2 IgG) .

Interactome Insights

YDR352W interacts with 92 proteins and participates in 100 interactions, as per BioGRID . Notable interactions include:

  • Vacuolar Trafficking Proteins: Likely partners in membrane remodeling and cargo transport.

  • Stress Response Pathways: Potential links to vacuolar pH regulation and amino acid storage.

Expression Data

No publicly available expression data exists for YDR352W in the Saccharomyces Genome Database (SGD) , indicating a gap in transcriptomic or proteomic studies.

Critical Considerations for Research

  1. Functional Studies: Limited data on substrate specificity or transport kinetics.

  2. Expression Systems: Native expression in yeast vs. recombinant E. coli may affect post-translational modifications.

  3. Experimental Design: Repeated freeze-thaw cycles and improper storage (-20°C/-80°C) compromise protein activity .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YPQ2; YDR352W; Probable vacuolar amino acid transporter YPQ2; PQ-loop repeat-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YPQ2
Target Protein Sequence
MSCSNGIWPTVSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSLI GAKLTGQLLFQILLAIYFLLNDSFVCGQYYYYGVLHENKLATVGHEPKPLLPELVENGEL LREEEDMIQGGSSAESPRSSRRRSAITAALAIAHTISTASAYPLNVGSTQSQVGPPGDGK NSQLGTILSWIGASFYVGARIPQLIKNYNRKSTDGLSPFLFATTLLCNITYNLSIFTSCR FLDNQNKREFIVNELPFIFGSAGTIAFDLIYFYQYYILYATDMQLRELERELYSPEEDSA AQLVTERTSLLSGETQT
Uniprot No.

Target Background

Function
This protein may function as a vacuolar amino acid transporter, mediating the export of cationic amino acids from the vacuole.
Database Links

KEGG: sce:YDR352W

STRING: 4932.YDR352W

Protein Families
Laat-1 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is YDR352W and what is its primary cellular function?

YDR352W is a putative vacuolar membrane transporter for cationic amino acids in the yeast Saccharomyces cerevisiae. Its primary function involves contributing to amino acid homeostasis by exporting cationic amino acids from the vacuole to the cytosol. The protein belongs to the PQ-loop family and contains seven transmembrane domains, which are characteristic of membrane transporters. Notably, the functional role of YDR352W is conserved across species, as demonstrated by complementation studies showing that its mutant phenotype can be functionally rescued by the rat PQLC2 vacuolar transporter . This conservation suggests an evolutionarily important role in vacuolar amino acid transport mechanisms across eukaryotes.

Where is YDR352W predominantly localized within the cell?

Based on comprehensive localization studies, YDR352W is predominantly localized to the vacuole and vacuolar membrane compartments. Quantitative localization data shows that across various growth conditions and genetic backgrounds, YDR352W consistently displays its highest localization scores in the vacuolar membrane, with values typically ranging from 0.52-0.88 across different experimental conditions . This strong vacuolar localization pattern is maintained even under stress conditions and in different mutant backgrounds. While small amounts of the protein may occasionally be detected in other compartments such as the cytoplasm, nuclear periphery, and mitochondria, these appear to be minor populations compared to the predominant vacuolar localization, which aligns with its proposed function as a vacuolar membrane transporter .

How does YDR352W expression change throughout the cell cycle?

YDR352W shows notable expression changes throughout the cell cycle phases. According to the gene expression data, YDR352W exhibits higher expression during G1 post-START and telophase compared to other cell cycle phases. For instance, in replicate 1 (R1), gene expression levels were measured at 29.49 in G1 post-START and 25.49 in telophase, compared to lower values of 16.11 in metaphase . This pattern is similarly reflected in replicate 2 (R2), with values of 33.52 in G1 post-START and 31.36 in telophase. The consistently lower expression during metaphase across replicates (16.11 in R1 and 19.76 in R2) suggests cell cycle-dependent regulation of this gene. This periodic expression pattern may indicate that YDR352W's function in amino acid homeostasis is particularly important during specific cell cycle transitions, possibly when cells require enhanced vacuolar amino acid export for protein synthesis or other metabolic processes .

What techniques can be used to study the transport activity of YDR352W?

To study YDR352W transport activity, researchers should employ complementary approaches that assess both in vivo and in vitro activity. For in vivo studies, fluorescently labeled amino acid analogs can be used to track transport across the vacuolar membrane in wild-type and YDR352W deletion strains. Time-course microscopy with these analogs will reveal differences in transport kinetics. Complementary to this, vacuole isolation protocols can be optimized for transport assays where purified vacuoles are incubated with radiolabeled cationic amino acids, allowing measurement of uptake or efflux rates under various conditions . For in vitro characterization, the protein should be recombinantly expressed with appropriate tags for purification while maintaining functionality, followed by reconstitution into proteoliposomes. These proteoliposomes can then be used for transport assays with varying substrate concentrations to determine kinetic parameters and substrate specificity profiles. Finally, electrophysiological techniques such as patch-clamping of vacuolar membranes or reconstituted systems can provide direct evidence of transport activity and mechanisms .

How do mutations in YDR352W affect amino acid homeostasis and what phenotypes emerge?

Mutations in YDR352W lead to complex changes in cellular amino acid homeostasis, particularly affecting cationic amino acid distribution between vacuoles and cytosol. YDR352W knockout strains typically exhibit enlarged vacuoles with increased accumulation of basic amino acids (arginine, lysine, histidine) due to impaired export capacity. These strains show growth defects under conditions requiring rapid mobilization of amino acid reserves, such as nitrogen starvation followed by refeeding . The phenotypes become more pronounced when combined with mutations in cytosolic amino acid biosynthesis pathways. Metabolomic analysis reveals not only changes in cationic amino acid levels but also downstream metabolic consequences affecting nitrogen metabolism and possibly TOR signaling pathways. Interestingly, these phenotypes can be rescued by expressing rat PQLC2, confirming functional conservation . To systematically study these effects, researchers should employ a combination of growth assays under varied nutrient conditions, metabolomics to profile intracellular and vacuolar amino acid content, and fluorescence-based sensors to monitor real-time changes in amino acid concentrations in different cellular compartments.

What is the relationship between YDR352W and other vacuolar transporters in maintaining amino acid homeostasis?

YDR352W functions within a complex network of vacuolar transporters that collectively maintain amino acid homeostasis. To study these relationships, researchers should conduct genetic interaction studies through systematic double-knockout combinations of YDR352W with other vacuolar transporters, particularly those involved in amino acid transport. Synthetic genetic array (SGA) analysis can reveal functional redundancies or dependencies . Quantitative phenotypic analysis of these mutants under various nutrient conditions will highlight condition-specific relationships. Proximity labeling approaches such as BioID or APEX can identify physical interactions between YDR352W and other transporters or regulatory proteins at the vacuolar membrane. Additionally, systems biology approaches combining transcriptomics and proteomics data from vacuolar transporter mutants would reveal compensatory mechanisms and regulatory networks . Particular attention should be paid to the interplay between YDR352W and AVT-family transporters, as well as connections to signaling pathways like TORC1 that sense amino acid availability. This integrated approach will elucidate how YDR352W contributes to the vacuolar amino acid transport network and cellular homeostasis.

How can I optimize recombinant expression of YDR352W for structural studies?

Successful recombinant expression of YDR352W for structural studies requires careful optimization of multiple parameters. First, select an appropriate expression system - while E. coli is convenient, membrane proteins often express better in eukaryotic systems like Pichia pastoris or insect cells that provide proper folding machinery and membrane environment. Design constructs with different fusion tags (His, FLAG, MBP) positioned at either terminus, testing which combination preserves functionality while enhancing expression and purification yields . Include a cleavable fluorescent protein tag to monitor expression and localization during optimization. For detergent screening, systematically test mild detergents (DDM, LMNG, GDN) for extraction efficiency while maintaining protein stability. Consider lipid-based approaches like SMALPs or nanodiscs that maintain the native lipid environment. Thermostability assays should guide buffer optimization, identifying conditions that maximize protein stability. For structural studies specifically, implement limited proteolysis to identify and remove flexible regions that might hinder crystallization or high-resolution cryo-EM analysis . Throughout optimization, regularly verify functionality using transport assays to ensure structural relevance of the recombinant protein.

What approaches can be used to identify the substrate specificity of YDR352W?

Determining the substrate specificity of YDR352W requires a multi-faceted approach combining in vivo and in vitro methods. Begin with competition assays using purified vacuoles or YDR352W-expressing proteoliposomes, where transport of a known substrate is measured in the presence of potential competing substrates. This helps establish the range of molecules recognized by the transporter . Develop a systematic substrate screening platform using vacuoles isolated from YDR352W-overexpressing and knockout strains, testing a comprehensive panel of amino acids and related compounds with varying properties (charge, size, hydrophobicity). Supplement biochemical assays with in vivo metabolic profiling, comparing intracellular and vacuolar metabolites between wild-type and YDR352W mutant strains under various conditions to identify physiologically relevant substrate differences . For direct binding studies, employ techniques like surface plasmon resonance or microscale thermophoresis with purified protein to measure binding affinities for potential substrates. Finally, computational approaches such as homology modeling with docking simulations can predict substrate binding sites, generating hypotheses that can be tested through site-directed mutagenesis and functional assays. This integrated approach will provide comprehensive insights into YDR352W substrate specificity.

How can I study the regulation of YDR352W under different nutrient conditions?

To investigate YDR352W regulation under varying nutrient conditions, implement a comprehensive experimental strategy examining transcriptional, translational, and post-translational regulation mechanisms. Begin with reporter assays using the YDR352W promoter fused to fluorescent proteins or luciferase to track transcriptional changes across nutrient conditions (nitrogen starvation, amino acid depletion, carbon source variations). This should be complemented with RT-qPCR and northern blot analysis to directly quantify mRNA levels . For translational regulation, ribosome profiling will reveal translation efficiency changes, which can be compared with the existing translational efficiency data showing values ranging from 0.8320 to 1.3780 across cell cycle stages . Post-translational regulation can be assessed by western blotting with phospho-specific antibodies or mass spectrometry-based phosphoproteomics to identify modifications in response to nutrient signals. To study protein turnover, implement cycloheximide chase assays under different nutrient conditions. Advanced microscopy with fluorescently-tagged YDR352W will reveal changes in localization and abundance, particularly important given the protein's predominant vacuolar membrane localization (values consistently above 0.5 across conditions) . Finally, genetic approaches using deletions of nutrient-sensing pathway components will help establish regulatory hierarchies controlling YDR352W expression and function.

How do I interpret YDR352W localization changes in response to cellular stress?

When interpreting YDR352W localization changes under stress conditions, analyze both quantitative distribution patterns and qualitative morphological changes. The provided localization data shows that while YDR352W maintains predominant vacuolar membrane localization across conditions (values ranging from 0.52-0.88), subtle shifts occur under stress . For example, during rapamycin treatment (RAP series), there's a gradual decrease in vacuolar membrane localization (from 0.78 at RAP60 to 0.52 at RAP620) with corresponding increases in cytoplasmic localization (from 0.1 to 0.26) . These changes should be interpreted as potential stress-responsive trafficking events rather than mislocalization artifacts. To properly analyze such data, normalize localization values across compartments for each condition and apply statistical tests to determine significant changes. Consider vacuolar morphology changes that occur during stress responses, as fragmentation or fusion events can affect apparent protein distribution without changing actual membrane association. Time-course experiments with live-cell imaging will reveal the dynamics of these changes, distinguishing between rapid relocalization versus changes in protein synthesis or degradation patterns . Finally, correlate localization changes with functional assays to determine whether redistribution affects transport activity.

What do the UBP2/UBP14 deletion data reveal about YDR352W regulation?

The UBP2/UBP14 deletion data reveals important insights into post-translational regulation of YDR352W through the ubiquitin pathway. The intensity change data (log2) shows that UBP14 deletion causes a consistent upregulation of YDR352W (0.091597, 0.159269, and 0.126086 log2 fold change across replicates), while UBP2 deletion shows a slight downregulation (-0.031591, -0.046961, -0.039314) . This pattern suggests that UBP14, a deubiquitinating enzyme, normally functions to reduce YDR352W levels, possibly by stabilizing a negative regulator or by directly affecting YDR352W ubiquitination state. The double deletion (UBP2UBP14) shows intermediate values (0.044591, 0.090510, 0.067908), indicating complex interplay between these deubiquitinases . To interpret this properly, researchers should consider UBP14's known role in disassembling free polyubiquitin chains versus UBP2's function in editing ubiquitin chains on substrates. The localization data for different cellular compartments in these mutants further suggests that these regulatory pathways affect not just protein levels but also subcellular distribution patterns. These findings point to a complex regulatory system where ubiquitination/deubiquitination dynamics influence both the abundance and localization of YDR352W, potentially as part of stress or nutrient-responsive pathways .

How can discrepancies in YDR352W localization data across different studies be reconciled?

When reconciling discrepancies in YDR352W localization data across studies, researchers must consider multiple technical and biological factors that influence experimental outcomes. First, evaluate methodological differences - GFP-tagging location (N-terminal versus C-terminal) can significantly affect membrane protein localization, as can the fixation methods used for immunofluorescence. The quantitative data shows predominant vacuolar membrane localization (consistently above 0.5 across conditions), but smaller populations appear in other compartments like the nuclear periphery (values typically 0.05-0.2) . These minor localizations might represent genuine subpopulations, proteins in transit, or artifacts of overexpression. Experimental conditions matter significantly - the data shows condition-dependent changes, such as increased cytoplasmic localization during rapamycin treatment (increasing from 0.05 to 0.26) . Cell cycle stage also influences localization patterns, as protein distribution can vary between dividing and non-dividing cells. To reconcile discrepancies, researchers should standardize methods, use complementary approaches (fluorescent tagging, immunolocalization, biochemical fractionation), control for expression levels, and carefully document growth conditions and cell cycle stages. Functional validation through transport assays of different cellular fractions can help determine which localization pattern represents the functionally relevant pool of the protein.

What are the challenges in distinguishing between direct and indirect effects of YDR352W deletion?

Distinguishing between direct and indirect effects of YDR352W deletion presents several challenges requiring systematic experimental approaches. The primary challenge stems from the interconnected nature of amino acid homeostasis networks, where altering one transporter can trigger compensatory changes in related pathways. To address this, researchers should implement acute inactivation systems rather than relying solely on conventional knockouts - techniques like auxin-inducible degrons or rapid chemical inhibition of YDR352W can reveal immediate effects before compensatory mechanisms activate . Time-resolved experiments capturing changes at multiple time points post-inactivation help separate primary from secondary effects. Combining these approaches with metabolomics reveals the sequence of metabolic changes, where direct effects manifest immediately while indirect effects appear progressively. Complementation experiments using YDR352W variants with altered transport properties but intact structural features can distinguish between transport-dependent and structure-dependent functions . System-level approaches are especially valuable - comparative transcriptomics and proteomics between acute and chronic YDR352W loss models reveal adaptive responses, while genetic interaction mapping identifies genes that buffer or exacerbate YDR352W deletion effects. These comprehensive strategies collectively enable researchers to delineate the direct functions of YDR352W from downstream consequences of its absence.

How can I develop fluorescent sensors to monitor YDR352W transport activity in vivo?

Developing fluorescent sensors for monitoring YDR352W transport activity in vivo requires strategic design choices based on the protein's function as a cationic amino acid transporter. Start by creating genetically encoded FRET-based sensors that respond to concentration changes of YDR352W substrates like arginine or lysine. These sensors should incorporate bacterial periplasmic binding proteins (PBPs) that undergo conformational changes upon amino acid binding, flanked by appropriate fluorescent protein pairs (such as mCerulean/mVenus) for optimal FRET efficiency . For vacuole-specific targeting, add vacuolar targeting sequences from well-characterized proteins. Alternatively, develop pH-sensitive sensors that detect proton coupling during transport, particularly relevant as many transporters function through H+-coupled mechanisms. For direct activity monitoring, consider engineering conformation-sensitive fluorescent protein insertions within YDR352W itself at sites that undergo structural changes during the transport cycle, identified through molecular dynamics simulations . For sensor validation, compare responses in wild-type versus YDR352W knockout strains, and calibrate using ionophores to equilibrate substrate concentrations. Spatial resolution is critical - implement these sensors with high-resolution microscopy techniques that can distinguish vacuolar membrane from other compartments. Finally, optimize sensor expression levels to prevent artifacts from overexpression while maintaining sufficient signal for detection.

What approaches can overcome the challenges of studying a membrane protein with multiple transmembrane domains?

Studying YDR352W, with its seven transmembrane domains, presents significant technical challenges requiring specialized approaches. For structural studies, consider lipid cubic phase (LCP) crystallization, which provides a membrane-like environment conducive to membrane protein crystallization. Alternatively, implement single-particle cryo-EM with advanced detergent screening or lipid nanodiscs to maintain native conformation . To address expression difficulties, test multiple expression systems beyond standard yeast models, including mammalian cells, insect cells, or cell-free systems optimized for membrane proteins. For functional characterization without purification, develop split reporter assays where complementary fragments of reporters like luciferase are fused to different transmembrane regions, allowing monitoring of conformational changes during transport cycles . When conducting mutagenesis studies, implement scanning cysteine accessibility method (SCAM) to systematically map the substrate permeation pathway by introducing individual cysteines and testing their accessibility to thiol-reactive compounds from either side of the membrane. For protein-protein interaction studies, proximity labeling approaches like BioID or APEX2 are preferable to traditional co-immunoprecipitation, which often disrupts membrane protein interactions. Finally, computational approaches including molecular dynamics simulations in explicit membrane environments can provide insights into conformational dynamics difficult to capture experimentally, generating testable hypotheses about transport mechanisms and substrate interactions .

How does YDR352W function compare to other PQ-loop family transporters across species?

The PQ-loop family of transporters, characterized by the presence of internal PQ-motifs, represents an evolutionarily conserved group spanning from bacteria to humans. YDR352W belongs to this family and shares functional similarities with mammalian counterparts despite moderate sequence identity. Comparative analysis shows that YDR352W's role in cationic amino acid transport from the vacuole is functionally analogous to the mammalian lysosomal transporter PQLC2, evidenced by cross-species complementation where rat PQLC2 rescues YDR352W mutant phenotypes . This functional conservation exists despite differences in substrate specificity ranges and transport kinetics that have evolved to meet organism-specific metabolic requirements. Structural comparisons based on hydropathy profiles indicate that the seven-transmembrane domain architecture is preserved across family members, with the most conserved regions corresponding to the transmembrane helices and PQ-loops . Regulatory mechanisms show greater divergence - while yeast YDR352W appears regulated primarily by nutrient availability, mammalian counterparts integrate into more complex signaling networks. To systematically study these relationships, researchers should implement comparative genomics approaches examining selective pressure on different domains, heterologous expression with functional assays across species, and detailed structure-function analyses focused on conserved versus divergent regions. This evolutionary perspective provides crucial context for understanding fundamental transport mechanisms conserved across eukaryotes.

What is the evolutionary significance of YDR352W conservation and how can it inform human lysosomal research?

The evolutionary conservation of YDR352W provides valuable insights into fundamental mechanisms of intracellular amino acid transport and has significant implications for human lysosomal research. The functional complementation between YDR352W and rat PQLC2 demonstrates conservation of core transport mechanisms from yeast vacuoles to mammalian lysosomes across approximately 1 billion years of evolutionary divergence . This conservation suggests that YDR352W participates in an ancient and essential cellular process for amino acid recycling and homeostasis. Yeast vacuoles and mammalian lysosomes share not only analogous degradative functions but also critical roles in amino acid storage and mobilization. Studying YDR352W provides a genetically tractable model for understanding principles applicable to human lysosomal cationic amino acid transport, relevant to conditions like cystinosis and lysosomal storage disorders . The evolutionary comparison reveals which protein domains and residues have remained invariant (likely essential for function) versus those that diverged (potentially species-specific adaptations). Researchers can leverage this conservation by using yeast as a platform for high-throughput functional screening of human PQLC2 variants identified in patients, rapidly assessing their impact through complementation assays. Additionally, the extensive genetic and biochemical tools available in yeast enable mechanistic studies difficult to perform in mammalian systems, generating insights that can be translated to human lysosomal research and potential therapeutic approaches for lysosomal storage disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.