Recombinant Saccharomyces cerevisiae Vacuolar membrane protein FOSTERSO_4058 (FOSTERSO_4058)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
FOSTERSO_4058; Vacuolar membrane protein FOSTERSO_4058
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain FostersO) (Baker's yeast)
Target Names
FOSTERSO_4058
Target Protein Sequence
MXKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGX TSSSSLIVASITPPSTVGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSXYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII
Uniprot No.

Target Background

Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

How does FOSTERSO_4058 compare to other vacuolar membrane proteins in yeast?

FOSTERSO_4058 belongs to a larger family of vacuolar membrane proteins in Saccharomyces cerevisiae. Comparative analysis shows it shares structural features with other vacuolar transporters, particularly in the transmembrane domains. Research has identified 148 proteins significantly enriched in pure vacuolar preparations, with FOSTERSO_4058 being among them .

When studying this protein in comparison to others, researchers should consider:

  • Sequence homology analysis with other vacuolar proteins

  • Structural domain comparison

  • Functional complementation studies

  • Evolutionary conservation patterns across yeast species

A methodological approach involves using multiple sequence alignment tools (MUSCLE, Clustal Omega) followed by phylogenetic analysis to determine evolutionary relationships. For functional comparison, heterologous expression systems coupled with transport assays can reveal similarities and differences in substrate specificity.

What are the optimal conditions for expressing recombinant FOSTERSO_4058?

The optimal expression of recombinant FOSTERSO_4058 requires careful consideration of several parameters. Based on current protocols, successful expression has been achieved using E. coli as the host system with a His-tag for purification purposes .

ParameterRecommended ConditionRationale
Expression HostE. coli BL21(DE3)High protein yield, reduced proteolysis
VectorpET-based vectorsTight regulation of expression
Induction0.5-1.0 mM IPTG, 18°C overnightLower temperature reduces inclusion body formation
MediaLB supplemented with glucoseSupports membrane protein production
Cell LysisMechanical disruption with French pressPreserves protein integrity
PurificationNi-NTA affinity chromatographyUtilizes His-tag for selective binding

For membrane proteins like FOSTERSO_4058, researchers should take special precautions to maintain proper folding. Consider using mild detergents (DDM, LDAO) during extraction and purification to maintain the native conformation of the protein.

When planning expression experiments, it's crucial to monitor protein quality through multiple methods (SDS-PAGE, Western blot, mass spectrometry) to ensure structural integrity before proceeding to functional studies.

How should researchers design experiments to study the transport function of FOSTERSO_4058?

Designing experiments to study transport function requires careful consideration of membrane protein characteristics and appropriate experimental systems. The following methodological approach is recommended:

  • Reconstitution in proteoliposomes:

    • Purify FOSTERSO_4058 protein using affinity chromatography

    • Reconstitute in lipid vesicles containing phosphatidylcholine and phosphatidylethanolamine

    • Establish pH or ion gradients across the vesicles

    • Measure substrate transport using fluorescent probes or radiolabeled compounds

  • Whole-cell transport assays:

    • Generate FOSTERSO_4058 knockout strains using CRISPR-Cas9 or homologous recombination

    • Compare transport abilities between wild-type and knockout cells

    • Complement knockouts with site-directed mutants to identify critical residues

  • Electrophysiological studies:

    • Express FOSTERSO_4058 in Xenopus oocytes or patch-clamped cells

    • Measure current changes in response to potential substrates

For meaningful results, experiments should include appropriate controls such as inactive mutants and competitive inhibitors. Statistical power calculations, as described by Burlig et al., should be performed to determine adequate sample sizes for detecting transport activity differences .

How should researchers analyze contradictory data regarding FOSTERSO_4058 function?

When faced with contradictory results in studies of FOSTERSO_4058, researchers should employ a systematic approach to resolve discrepancies:

  • Examine experimental conditions:

    • Compare buffer compositions, pH, temperature, and other variables

    • Evaluate protein purity and integrity in each experiment

    • Assess whether differences in expression systems could account for functional variations

  • Apply statistical rigor:

    • Implement robust statistical methods to determine if contradictions are statistically significant

    • Consider power calculations to ensure adequate sample sizes

    • Use appropriate statistical tests for the data type (parametric vs. non-parametric)

  • Consider biological context:

    • Evaluate whether contradictions might represent different physiological states

    • Assess if post-translational modifications might explain functional differences

    • Determine if protein interactions vary between experimental systems

  • Meta-analysis approach:

    • Systematically combine data from multiple experiments

    • Weight findings based on methodological strength

    • Identify patterns that may explain seemingly contradictory results

What are the best practices for presenting FOSTERSO_4058 research data in publications?

Effective presentation of FOSTERSO_4058 research data requires thoughtful organization and format selection. The following methodological approach is recommended:

  • Data selection and organization:

    • Present only data that directly answers research questions

    • Organize data into logical categories (structural, functional, comparative)

    • Start with general findings, then proceed to specific details

  • Format selection guidelines:

Data TypeBest FormatExample for FOSTERSO_4058
Precise numerical valuesTablesKinetic parameters of transport activity
Trends and patternsFigures/GraphsChanges in transport activity under various conditions
Complex relationshipsFlowchartsInteraction network with other vacuolar proteins
Simple findingsText descriptionBasic characterization results
  • Table construction best practices:

    • Include clear, descriptive titles that summarize content

    • Use column headers that precisely indicate data type

    • Present standard deviations to show data precision

    • Highlight statistically significant findings with appropriate notation

  • Avoiding common pitfalls:

    • Prevent data redundancy across text, tables, and figures

    • Ensure tables and figures are self-explanatory with comprehensive legends

    • Maintain consistent units and formatting throughout

    • Use past tense when describing results

When presenting comparative data between FOSTERSO_4058 and other proteins, consider using a hierarchical clustering approach to visualize relationships rather than simple listing, as this provides greater context for interpretation.

What methodological approaches can be used to identify interaction partners of FOSTERSO_4058?

Identifying protein-protein interactions for membrane proteins like FOSTERSO_4058 requires specialized techniques that account for their hydrophobic nature and native membrane environment:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express FOSTERSO_4058 with an affinity tag (His or FLAG)

    • Cross-link protein complexes in vivo using membrane-permeable reagents

    • Solubilize membranes with mild detergents

    • Purify complexes and identify components by mass spectrometry

  • Proximity-based labeling approaches:

    • Fuse FOSTERSO_4058 with BioID or APEX2 enzymes

    • Allow proximity-dependent labeling of neighboring proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach is particularly valuable for transient interactions

  • Split-protein complementation assays:

    • Fuse FOSTERSO_4058 and candidate interactors with complementary fragments of reporter proteins

    • Monitor reporter activity as indication of protein proximity

    • Examples include split-GFP, split-luciferase, or yeast two-hybrid variants

  • Correlation analysis from proteomics data:

    • Analyze large-scale quantitative proteomics datasets

    • Identify proteins whose abundance correlates with FOSTERSO_4058

    • Use computational methods to predict functional associations

This methodological framework has successfully identified numerous vacuolar protein interactions in yeast . When analyzing results, researchers should validate key interactions through multiple independent techniques and consider the impact of detergents on the integrity of protein complexes.

What are the most promising future research directions for FOSTERSO_4058?

Based on current knowledge gaps, the following research directions show significant promise:

  • Structural biology approaches:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Perform molecular dynamics simulations to understand transport mechanisms

    • Identify structural changes during substrate binding and transport

  • Systems biology integration:

    • Position FOSTERSO_4058 within the broader context of vacuolar function

    • Develop predictive models of vacuolar transport networks

    • Identify synthetic genetic interactions through genome-wide screens

  • Comparative analysis across species:

    • Identify and characterize orthologs in pathogenic fungi

    • Explore evolutionary conservation of function

    • Assess potential as antifungal target

  • Development of specific inhibitors:

    • Design assays suitable for high-throughput screening

    • Identify compounds that specifically modulate FOSTERSO_4058 activity

    • Characterize mechanisms of inhibition

These research directions should be pursued with rigorous experimental design principles, including appropriate controls, statistical power calculations, and clear hypothesis testing frameworks . Researchers should also consider employing newer technologies such as CRISPR-Cas9 for precise genome editing and advanced imaging techniques for dynamic studies of protein function in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.