Recombinant Saccharomyces cerevisiae Vacuolar membrane protein QA23_4119 (QA23_4119)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
QA23_4119; Vacuolar membrane protein QA23_4119
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast)
Target Names
QA23_4119
Target Protein Sequence
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII
Uniprot No.

Target Background

Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

How is recombinant QA23_4119 protein typically expressed and purified?

For efficient expression and purification of recombinant QA23_4119, the protein is commonly expressed in E. coli expression systems . The procedure follows standard recombinant protein production protocols:

  • Clone the QA23_4119 gene into an appropriate expression vector with an N-terminal His-tag

  • Transform into a compatible E. coli strain (commonly BL21(DE3) or derivatives)

  • Induce expression using IPTG or auto-induction media

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Further purify using size exclusion chromatography if needed

  • Concentrate and lyophilize the protein

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis . Researchers should optimize expression conditions including temperature, induction time, and media composition to maximize yield and minimize inclusion body formation.

What are the optimal storage conditions for recombinant QA23_4119 protein?

To maintain the stability and activity of recombinant QA23_4119, proper storage is essential. The protein is typically provided as a lyophilized powder and should be stored at -20°C or -80°C upon receipt . After reconstitution, the following guidelines should be followed:

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity

For experiments requiring precise protein concentrations, researchers should measure protein concentration after reconstitution using standard methods such as Bradford assay or BCA assay.

How should I design experiments to study QA23_4119 function in vacuolar membranes?

When investigating QA23_4119 function in vacuolar membranes, a systematic experimental approach is recommended. Begin by clearly defining your research question and identifying relevant variables:

Research AspectIndependent VariableDependent VariableControls
LocalizationExpression level of QA23_4119Subcellular distributionWild-type cells, cells with known vacuolar markers
Membrane dynamicsTemperature, pH, or osmotic stressMembrane integrity, protein distributionUnstressed cells, cells with other membrane proteins
Protein interactionsPresence/absence of potential binding partnersCo-immunoprecipitation resultsGST-tag only, unrelated proteins

For proper experimental design:

  • Generate knockout strains using CRISPR-Cas9 or traditional homologous recombination methods to create QA23_4119-deficient yeast strains

  • Create complementary strains with tagged versions of the protein for visualization

  • Use fluorescence microscopy to track protein localization under different conditions

  • Employ biochemical assays such as co-immunoprecipitation to identify interacting proteins

  • Use quantitative proteomics to measure changes in the vacuolar proteome in response to QA23_4119 perturbation

This systematic approach helps control for extraneous variables and confounding factors that might influence your results .

What methodologies are recommended for analyzing QA23_4119 interactions with other vacuolar proteins?

To identify and characterize interactions between QA23_4119 and other vacuolar proteins, multiple complementary approaches should be employed:

  • Yeast Two-Hybrid Analysis: Use QA23_4119 as bait to screen for potential interacting partners, followed by validation using more direct methods.

  • Co-immunoprecipitation: Express epitope-tagged QA23_4119 in yeast, isolate protein complexes using antibodies against the tag, and identify co-precipitating proteins by mass spectrometry.

  • Proximity Labeling: Fuse QA23_4119 to BioID or APEX2 enzymes to biotinylate proteins in close proximity, followed by streptavidin pulldown and mass spectrometry.

  • Fluorescence Resonance Energy Transfer (FRET): Tag QA23_4119 and candidate interacting proteins with appropriate fluorophores to measure energy transfer indicating direct interaction.

  • Bimolecular Fluorescence Complementation (BiFC): Split a fluorescent protein between QA23_4119 and potential partners to visualize interactions through reconstituted fluorescence.

For data analysis, ensure appropriate statistical methods are applied to distinguish specific from non-specific interactions. The integration of multiple methodologies provides robust evidence for protein-protein interactions and minimizes false positives .

How can I effectively compare wild-type and mutant forms of QA23_4119 in functional assays?

  • Mutation Selection: Choose mutations based on predicted functional domains, conserved residues, or identified post-translational modification sites.

  • Expression Level Control: Ensure that wild-type and mutant proteins are expressed at comparable levels, as differences in expression can confound functional comparisons.

  • Experimental Design Matrix:

Protein VariantExpression VectorPromoterTag PositionStrain Background
Wild-typepRS416NativeC-terminalBY4741 (wild-type)
Wild-typepRS416NativeC-terminalQA23_4119Δ
Mutant 1pRS416NativeC-terminalQA23_4119Δ
Mutant 2pRS416NativeC-terminalQA23_4119Δ
  • Complementation Analysis: Express mutants in QA23_4119-deficient strains to assess functional rescue.

  • Phenotypic Assays: Measure relevant phenotypes such as vacuolar morphology, pH, protein sorting, or stress responses.

  • Localization Studies: Compare subcellular localization using fluorescence microscopy to determine if mutations affect protein targeting.

  • Statistical Analysis: Use appropriate statistical tests (e.g., ANOVA with post-hoc tests) to evaluate differences between wild-type and mutant proteins .

This approach allows for rigorous comparison while controlling for potential confounding variables that could affect interpretation of the results.

What role does QA23_4119 play in the stress response mechanisms of Saccharomyces cerevisiae?

The role of QA23_4119 in stress response mechanisms can be investigated through comprehensive stress testing protocols. S. cerevisiae possesses remarkable resilience to adverse conditions of osmolarity and low pH, with vacuolar proteins playing critical roles in these responses .

To systematically evaluate QA23_4119's role in stress responses:

  • Stress Condition Panel: Subject wild-type and QA23_4119-deleted strains to various stressors:

    • Osmotic stress (NaCl, sorbitol)

    • pH stress (acidic and alkaline conditions)

    • Oxidative stress (H₂O₂, menadione)

    • Temperature stress (heat shock, cold shock)

    • Nutrient limitation (carbon, nitrogen starvation)

  • Quantitative Growth Analysis: Monitor growth using automated plate readers to generate precise growth curves under each condition.

  • Transcriptional Response: Use RNA-seq to compare transcriptional profiles between wild-type and mutant strains under stress conditions.

  • Metabolomic Analysis: Measure changes in metabolite levels using LC-MS or GC-MS to identify metabolic adaptations dependent on QA23_4119.

  • Vacuolar Function Assays: Assess vacuolar pH, morphology, and fusion events during stress using fluorescent probes and microscopy.

Research findings indicate that many vacuolar membrane proteins in S. cerevisiae contribute to the "make-accumulate-consume" lifestyle that allows yeast to thrive in competitive environments . Determining if QA23_4119 participates in this process would provide valuable insights into yeast stress physiology.

How does phosphorylation affect QA23_4119 function and localization?

Post-translational modifications, particularly phosphorylation, can significantly impact protein function and localization. Analysis of the QA23_4119 sequence reveals multiple potential phosphorylation sites, particularly in the C-terminal region where serine/threonine-rich sequences are present.

To investigate the role of phosphorylation:

  • Phosphosite Prediction and Mapping:

    • Use bioinformatics tools (NetPhos, PhosphoSitePlus) to predict likely phosphorylation sites

    • Perform mass spectrometry analysis of purified QA23_4119 to identify actual phosphorylated residues

    • Compare phosphorylation status under different growth conditions or stresses

  • Phosphomimetic and Phosphodeficient Mutants:

    • Generate serine/threonine to alanine mutations (phosphodeficient)

    • Generate serine/threonine to glutamate/aspartate mutations (phosphomimetic)

    • Express these mutants in QA23_4119Δ background

  • Kinase Identification:

    • Screen kinase deletion library for effects on QA23_4119 phosphorylation

    • Perform in vitro kinase assays with purified kinases and QA23_4119

    • Use specific kinase inhibitors to validate in vivo

  • Functional Consequences:

    • Monitor vacuolar morphology and function in phosphomutants

    • Assess protein localization using fluorescence microscopy

    • Measure protein-protein interactions with and without phosphorylation

Phosphorylation often serves as a regulatory mechanism for vacuolar proteins in response to environmental changes or cell cycle progression. The detailed analysis of QA23_4119 phosphorylation will provide insights into its regulation and function within the complex framework of vacuolar membrane dynamics.

What are the evolutionary implications of QA23_4119 conservation across fungal species?

Evolutionary analysis of QA23_4119 can provide valuable insights into its functional importance and adaptation across fungal lineages. S. cerevisiae has been subject to both vertical evolution and horizontal gene transfer events throughout its evolutionary history .

To investigate the evolutionary aspects of QA23_4119:

  • Sequence Conservation Analysis:

    • Perform BLAST searches to identify homologs in diverse fungal species

    • Construct multiple sequence alignments to identify conserved domains

    • Calculate selection pressures (dN/dS ratios) across the protein sequence

  • Comparative Genomics:

    • Map syntenic regions containing QA23_4119 homologs across fungal genomes

    • Identify gene duplication or loss events in different lineages

    • Correlate evolutionary patterns with ecological niches of different fungi

  • Functional Complementation:

    • Test if QA23_4119 homologs from other fungi can complement deletion in S. cerevisiae

    • Identify species-specific functional adaptations through domain swapping experiments

  • Evolutionary Rate Analysis:

    • Compare evolutionary rates of QA23_4119 with other vacuolar membrane proteins

    • Identify regions under positive or purifying selection

What are common challenges in expressing and purifying functional QA23_4119 protein?

Membrane proteins like QA23_4119 present specific challenges during recombinant expression and purification. Common issues and their solutions include:

ChallengeCauseSolution
Low expression levelsToxicity to host, codon biasUse tunable promoters, codon optimization, specialized E. coli strains
Inclusion body formationImproper folding, hydrophobic regionsLower induction temperature (16-18°C), use solubility tags, add detergents
Poor solubilityHydrophobic transmembrane domainsInclude appropriate detergents in lysis and purification buffers
Low purityNon-specific binding to purification resinOptimize imidazole concentration in wash buffers, consider tandem purification
Protein aggregationInstability in solutionInclude stabilizing agents (glycerol, specific lipids) in storage buffer
Loss of functionDenaturation during purificationValidate using functional assays, consider native purification methods

For optimal expression, specialized E. coli strains designed for membrane proteins (e.g., C41(DE3), C43(DE3)) often yield better results. During purification, maintaining an appropriate detergent concentration above the critical micelle concentration is essential to prevent protein aggregation .

To verify proper folding and function, developing specific activity assays or structural characterization methods is recommended before proceeding to downstream applications.

How can I optimize immunofluorescence protocols for studying QA23_4119 localization?

Visualizing vacuolar membrane proteins like QA23_4119 through immunofluorescence requires careful optimization due to the complex architecture of yeast cells and potential accessibility issues. A comprehensive optimization protocol includes:

  • Sample Preparation:

    • Test different fixation methods (4% paraformaldehyde vs. methanol)

    • Optimize spheroplasting conditions to remove cell wall while preserving membrane structures

    • Compare mild detergents (0.1% Triton X-100, 0.05% Saponin) for permeabilization

  • Antibody Selection and Validation:

    • Generate specific antibodies against QA23_4119 or use antibodies against epitope tags

    • Validate antibody specificity using western blot on wild-type vs. QA23_4119Δ strains

    • Determine optimal antibody dilutions (typically starting with 1:100-1:1000)

  • Signal Optimization:

    • Test different blocking solutions (3-5% BSA, 5-10% normal serum)

    • Compare signal amplification methods (tyramide signal amplification, secondary antibody conjugates)

    • Optimize incubation times and temperatures for primary and secondary antibodies

  • Counterstaining:

    • Use established vacuolar markers (FM4-64, CMAC) for co-localization

    • Include nuclear stain (DAPI) for reference

    • Consider additional organelle markers to distinguish from other cellular compartments

  • Imaging Parameters:

    • Determine optimal exposure settings to avoid photobleaching

    • Use appropriate filters to minimize spectral overlap

    • Employ deconvolution or super-resolution techniques for detailed localization

This systematic optimization ensures reliable and reproducible visualization of QA23_4119 in its native context within the vacuolar membrane system.

How can I resolve technical issues when measuring QA23_4119 protein-protein interactions?

Protein-protein interaction studies with membrane proteins like QA23_4119 present unique technical challenges. Here are strategies to overcome common issues:

  • Non-specific Interactions:

    • Increase stringency of washing buffers (higher salt concentration, mild detergents)

    • Include competing proteins (BSA) to reduce non-specific binding

    • Perform parallel experiments with unrelated membrane proteins as negative controls

    • Use quantitative methods to establish significance thresholds

  • Low Signal-to-Noise Ratio:

    • Optimize protein expression levels to avoid artificial aggregation

    • Use crosslinking agents to stabilize transient interactions

    • Employ more sensitive detection methods (fluorescent tags, amplified detection systems)

    • Consider membrane fractionation to enrich for vacuolar membranes

  • Detergent Interference:

    • Test multiple detergent types (non-ionic, zwitterionic) at various concentrations

    • Consider detergent-free methods like styrene maleic acid lipid particles (SMALPs)

    • Use lipid nanodiscs to maintain a native-like membrane environment

  • Validation of Interactions:

    • Confirm interactions using multiple independent methods

    • Perform reciprocal co-immunoprecipitation experiments

    • Map interaction domains through truncation or point mutations

    • Assess biological relevance through functional assays

  • Data Analysis Challenges:

    • Implement appropriate statistical analysis for replicate experiments

    • Use quantitative proteomics (SILAC, TMT) for unbiased interaction screening

    • Apply computational filtering to remove common contaminants

By systematically addressing these challenges, researchers can generate more reliable and biologically meaningful data on QA23_4119 protein interactions within the complex environment of the vacuolar membrane.

What emerging technologies could advance our understanding of QA23_4119 function?

Several cutting-edge technologies hold promise for deepening our understanding of QA23_4119 function:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology and could provide high-resolution structures of QA23_4119 in its native membrane environment. This would reveal detailed insights into functional domains and potential interaction interfaces.

  • Proximity Labeling Proteomics: Techniques like TurboID or APEX2 could map the QA23_4119 interactome with temporal and spatial resolution, identifying both stable and transient interactions within the vacuolar membrane system.

  • Single-Molecule Tracking: These approaches can reveal the dynamics of QA23_4119 within living cells, including diffusion rates, clustering behavior, and responses to environmental changes.

  • CRISPR Base Editing: Precise modification of individual nucleotides could generate comprehensive mutation libraries to systematically assess structure-function relationships of QA23_4119.

  • Integrative Structural Biology: Combining multiple structural techniques (X-ray crystallography, NMR, SAXS, crosslinking mass spectrometry) could generate comprehensive structural models of QA23_4119 complexes.

  • Advanced Imaging Techniques: Super-resolution microscopy methods like STORM, PALM, or expansion microscopy could provide unprecedented detail on QA23_4119 localization within the complex architecture of vacuolar membranes.

These emerging technologies will enable researchers to address fundamental questions about QA23_4119 function that have been challenging with conventional approaches.

How might systems biology approaches enhance our understanding of QA23_4119 in cellular networks?

Systems biology approaches can contextualize QA23_4119 within broader cellular networks and reveal emergent properties not apparent from reductionist approaches:

  • Multi-omics Integration: Combining transcriptomics, proteomics, metabolomics, and lipidomics data from QA23_4119 mutants can reveal the broader impact of this protein on cellular physiology. This integrative approach could identify:

    • Transcriptional networks affected by QA23_4119 deletion

    • Changes in the vacuolar proteome composition

    • Alterations in lipid composition of vacuolar membranes

    • Metabolic shifts resulting from vacuolar dysfunction

  • Network Analysis: Constructing protein-protein interaction networks, genetic interaction maps, and metabolic networks involving QA23_4119 can identify:

    • Hub proteins connecting QA23_4119 to other cellular processes

    • Synthetic lethal or synthetic rescue interactions

    • Metabolic pathways influenced by QA23_4119 function

  • Mathematical Modeling: Developing predictive models of vacuolar function incorporating QA23_4119 could simulate:

    • Dynamics of vacuolar pH regulation

    • Membrane fusion and fission events

    • Nutrient storage and mobilization

    • Stress response mechanisms

  • Comparative Systems Analysis: Comparing system-level behaviors between wild-type yeast and industrial strains could reveal how QA23_4119 contributes to the unique properties of S. cerevisiae that make it valuable for various biotechnological applications .

These systems approaches will place QA23_4119 within its broader biological context and potentially identify unexpected connections to other cellular processes.

What potential biotechnological applications might emerge from detailed characterization of QA23_4119?

While avoiding commercial questions, it's important to consider how fundamental research on QA23_4119 might contribute to biotechnological innovations:

  • Bioengineering of Vacuolar Properties: Understanding QA23_4119 function could enable precise engineering of vacuolar properties in yeast, potentially enhancing:

    • Stress tolerance for improved fermentation efficiency

    • Protein production and secretion capabilities

    • Storage of valuable metabolites or compounds

  • Biosensor Development: QA23_4119 could potentially be engineered as a biosensor component for:

    • Monitoring vacuolar pH or membrane potential

    • Detecting specific metabolites or ions

    • Reporting on cellular stress states

  • Synthetic Biology Applications: QA23_4119 domains or regulatory elements could be incorporated into synthetic biology designs to:

    • Create novel membrane protein scaffolds

    • Develop controllable protein localization systems

    • Engineer new cellular compartmentalization strategies

  • Model System Advancement: Detailed characterization of QA23_4119 will enhance S. cerevisiae as a model system for understanding fundamental eukaryotic processes, potentially yielding insights applicable to human health research given the conservation of many cellular pathways .

The transition from fundamental research to applications requires deep understanding of protein function, which starts with addressing the basic and advanced research questions outlined in this FAQ collection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.