Recombinant Saccharomyces cerevisiae Vacuolar membrane protein SCRG_03194 (SCRG_03194)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request if possible.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering; we will accommodate your request if possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SCRG_03194; Vacuolar membrane protein SCRG_03194
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)
Target Names
SCRG_03194
Target Protein Sequence
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA
TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR
RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS
PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE
ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP
SMFLDDVLNGREII
Uniprot No.
Target Background
Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
