Recombinant Saccharomyces cerevisiae Vacuolar membrane protein SCY_4732 (SCY_4732)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
SCY_4732; Vacuolar membrane protein SCY_4732
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SCY_4732
Target Protein Sequence
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGT TSSSSLIVASITPPSTVGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSNYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII
Uniprot No.

Target Background

Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

How is recombinant SCY_4732 typically expressed and purified for research applications?

The expression and purification of recombinant SCY_4732 typically follows these methodological steps:

Expression System:

  • The protein is commonly expressed in E. coli expression systems rather than native yeast cells

  • Full-length (1-314 amino acids) or partial constructs can be generated depending on research needs

  • Expression constructs typically include affinity tags (commonly His-tag at the N-terminus) to facilitate purification

Purification Protocol:

  • Cell Lysis: Bacterial cells are disrupted to release expressed protein

  • Affinity Chromatography: His-tagged protein is captured using metal affinity chromatography

  • Quality Control: SDS-PAGE analysis confirms protein purity (typically >85-90%)

  • Final Preparation: The purified protein is typically supplied in either:

    • Lyophilized form for extended stability

    • Solution form with stabilizing agents (glycerol or trehalose)

This methodology mirrors approaches used for other membrane proteins, where careful consideration of detergents and buffer conditions is essential for maintaining native protein conformation .

What are the optimal storage conditions for maintaining SCY_4732 stability?

Based on manufacturer recommendations and protein biochemistry principles, the following storage conditions maximize SCY_4732 stability:

FormStorage TemperatureMaximum Shelf LifeSpecial Considerations
Lyophilized-20°C to -80°C12 monthsMost stable format for long-term storage
Liquid-20°C to -80°C6 monthsContains stabilizing agents
Working aliquots4°CUp to one weekFor immediate experimental use

Storage Buffer Composition:

  • Tris/PBS-based buffer, pH 8.0

  • 50% glycerol or 6% trehalose as cryoprotectants

Critical Handling Notes:

  • Repeated freeze-thaw cycles should be strictly avoided

  • Brief centrifugation prior to opening vials is recommended to collect contents

  • For reconstitution of lyophilized protein, use deionized sterile water to achieve 0.1-1.0 mg/mL concentration

  • After reconstitution, addition of 5-50% glycerol (final concentration) is recommended for aliquoting and storage

How can researchers verify the functional integrity of recombinant SCY_4732?

Verifying functional integrity is essential when working with membrane proteins like SCY_4732. While specific activity assays for SCY_4732 are not detailed in the provided literature, the following methodological approaches can be applied based on general membrane protein analysis techniques:

Structural Integrity Assessment:

  • Circular Dichroism (CD) Spectroscopy: Evaluates secondary structure content

  • Size Exclusion Chromatography (SEC): Confirms proper oligomeric state and homogeneity

  • Dynamic Light Scattering (DLS): Assesses aggregation state

Membrane Integration Analysis:

  • Liposome Reconstitution: Monitors protein incorporation into artificial membranes

  • Proteoliposome Flotation Assays: Confirms membrane association properties

Protein-Specific Functional Assays:

Consider adapting methodologies from hydrogen-deuterium exchange mass spectrometry (HDX-MS) studies, which have been successfully used to compare recombinant and native membrane proteins as described for other membrane proteins .

For vacuolar membrane proteins, function can often be assessed through:

  • Transport assays (if SCY_4732 has transport functions)

  • Protein-protein interaction studies with known vacuolar partners

  • In vivo complementation experiments in yeast deletion strains

What experimental approaches can be used to study SCY_4732 function in yeast systems?

Understanding SCY_4732 function requires multi-faceted experimental approaches:

Genetic Approaches:

  • Gene Knockout/Deletion: Create SCY_4732 deletion strains to observe phenotypic effects on vacuolar function

  • Complementation Studies: Rescue deletion phenotypes with wild-type or mutant variants

  • Genomic Tagging: Add fluorescent tags to study localization while maintaining native expression levels

Metabolic and Physiological Studies:

Yeast vacuolar function can be assessed through:

  • Growth Assays: Monitoring yeast growth under various stress conditions (pH, osmotic stress)

  • Vacuolar pH Monitoring: Using pH-sensitive fluorescent probes

  • Respiratory Analysis: SCY_4732 function may impact cellular respiration, which can be measured using approaches similar to those described for yeast respiration studies

Transcriptional Analysis:

  • Real-time RT-qPCR: Monitor expression changes under different conditions using validated reference genes as described for yeast dynamic expression studies

  • RNA-Seq: Perform genome-wide expression analysis in wild-type vs. SCY_4732 mutant strains

Specific Methodological Example:

For metabolic studies, researchers can adapt the respirometry approach described in result :

  • Prepare yeast suspensions with wild-type or SCY_4732 mutant strains

  • Measure CO₂ production using a simple respirometer

  • Record measurements at 2-minute intervals for at least 20 minutes

  • Calculate the rate of CO₂ production and glucose utilization using the Ideal Gas Law

  • Compare rates between wild-type and mutant strains to determine the impact of SCY_4732 on cellular metabolism

How can SCY_4732 serve as a model for studying membrane protein targeting to the vacuole?

SCY_4732 can serve as an excellent model system for investigating fundamental questions about vacuolar membrane protein targeting and function:

Targeting Signal Investigation:

  • Domain Mapping: Create truncated constructs to identify targeting signals

  • Fusion Protein Experiments: Generate chimeric proteins with SCY_4732 targeting domains fused to reporter proteins

  • Site-Directed Mutagenesis: Systematically mutate potential targeting motifs to identify essential residues

These approaches align with membrane anchoring strategies described for vacuolar targeting in plants, which may have parallels in yeast systems :

"Unique transmembrane and cytoplasmic tail sequences are used as anchors for delivering recombinant proteins via distinct vesicular transport pathways to specific vacuolar compartments where stable accumulation can occur."

Trafficking Pathway Elucidation:

  • Genetic Screens: Identify genes involved in SCY_4732 trafficking using yeast genomic resources

  • Drug Interference: Use trafficking inhibitors to determine the pathway(s) involved

  • Colocalization Studies: Visualize SCY_4732 trafficking in live cells using fluorescent markers for different compartments

Applications in Biotechnology:

Understanding SCY_4732 targeting mechanisms can inform the development of strategies for targeting recombinant proteins to vacuoles in various expression systems, as suggested by research on vacuolar targeting in plant bioproduction systems .

What approaches can be used to study SCY_4732 membrane topology?

Determining the membrane topology of SCY_4732 is crucial for understanding its structure-function relationship. Several complementary methodologies can be employed:

Computational Prediction:

  • Hydropathy Analysis: Identify potential transmembrane domains based on hydrophobicity plots

  • Topology Prediction Algorithms: Use tools like TMHMM, TopPred, or HMMTOP to predict membrane-spanning regions and their orientation

Experimental Validation:

  • Protease Protection Assays:

    • Isolate vacuoles containing SCY_4732

    • Treat with proteases with/without membrane permeabilization

    • Analyze proteolytic fragments to determine protected regions

  • Cysteine Scanning Mutagenesis:

    • Introduce cysteine residues at various positions

    • Test accessibility to membrane-impermeable sulfhydryl reagents

    • Determine which regions are accessible from which side of the membrane

  • Fluorescence-Based Approaches:

    • Generate GFP fusion constructs with insertions at different positions

    • Determine GFP fluorescence (which requires proper folding in the cytosol)

    • Map topology based on which insertions produce fluorescent protein

  • Glycosylation Mapping:

    • Introduce artificial glycosylation sites at various positions

    • Determine which sites become glycosylated (indicating lumenal orientation)

    • Map topology based on glycosylation patterns

These approaches can be adapted from methods used for studying other membrane proteins, including those mentioned in the research on recombinant membrane proteins .

What are the challenges in expressing and purifying full-length SCY_4732 while maintaining its native structure?

Expression and purification of membrane proteins like SCY_4732 present several challenges that must be addressed to obtain functionally relevant material:

Expression System Challenges:

  • Toxicity Issues: Overexpression of membrane proteins can be toxic to host cells

  • Folding Efficiency: E. coli may lack chaperones needed for proper folding of eukaryotic membrane proteins

  • Post-translational Modifications: E. coli cannot perform many eukaryotic post-translational modifications

Purification Challenges:

  • Detergent Selection: Finding detergents that effectively solubilize while preserving native structure

  • Membrane Extraction: Efficiently removing the protein from membranes without denaturing

  • Protein Stability: Maintaining stability outside the native membrane environment

Solution Strategies:

ChallengeMethodological Solution
Expression toxicityUse tightly controlled inducible systems; lower induction temperatures
Folding issuesCo-express with relevant chaperones; use specialized E. coli strains
Detergent selectionScreen multiple detergents; consider nanodisc or amphipol reconstitution
Stability concernsInclude stabilizing agents (glycerol, trehalose); optimize buffer components

Similar challenges have been addressed for other membrane proteins as described in result :

"Traditional approaches to membrane protein production frequently face limitations, such as producing proteins that are either locked in a single conformation or significantly altered through truncation and mutation. These methods can compromise the protein's functional integrity, resulting in samples that are impure, non-native, and less effective for research purposes."

How can structural studies of SCY_4732 be designed to maximize information yield?

Structural studies of membrane proteins like SCY_4732 require careful experimental design:

Sample Preparation Considerations:

  • Detergent Selection: Critical for maintaining native-like structure while allowing structural studies

  • Protein Homogeneity: Size-exclusion chromatography to ensure monodisperse samples

  • Stability Optimization: Buffer screening to identify conditions that maximize protein stability

Structural Biology Approaches:

  • X-ray Crystallography:

    • Requires high-quality crystals, challenging for membrane proteins

    • Lipidic cubic phase crystallization may improve success rates

    • Crystal engineering through surface mutations or fusion partners

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly powerful for membrane proteins without crystallization

    • May require larger protein complexes or antibody fragments for size enhancement

    • Sample vitrification conditions require optimization

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
    This technique has proven valuable for comparing recombinant and native membrane protein structures:

    "We used hydrogen-deuterium exchange mass spectrometry (HDX-MS) to generate a structural model of NadA and to compare the fold and structural dynamics of the recombinant NadA as soluble vaccine form, and the native NadA in situ, as embedded in meningococcal outer membrane vesicles (OMVs), complementing the HDX data with electron microscopy imaging."

  • NMR Spectroscopy:

    • Solution NMR for smaller domains

    • Solid-state NMR for full-length protein in membrane mimetics

    • Selective isotopic labeling to focus on specific regions

Functional Validation:

Correlate structural findings with functional assays to ensure biological relevance of the structural data obtained.

How can researchers investigate potential protein-protein interactions of SCY_4732?

Investigating protein-protein interactions of membrane proteins requires specialized approaches:

In Vitro Methods:

  • Pull-down Assays:

    • Immobilize purified SCY_4732 using affinity tags

    • Incubate with yeast cell lysates or purified candidate proteins

    • Identify interacting partners by mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize SCY_4732 on sensor chips

    • Measure binding kinetics with potential interacting partners

    • Determine affinity constants for specific interactions

  • Crosslinking Mass Spectrometry:

    • Use chemical crosslinkers to capture transient interactions

    • Digest crosslinked complexes and analyze by mass spectrometry

    • Identify interaction interfaces at amino acid resolution

In Vivo Methods:

  • Split-Ubiquitin Yeast Two-Hybrid:

    • Specially designed for membrane proteins

    • Fuse SCY_4732 to C-terminal ubiquitin fragment

    • Screen against library of proteins fused to N-terminal ubiquitin fragment

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse SCY_4732 to one half of fluorescent protein

    • Fuse candidate interactors to complementary half

    • Monitor fluorescence as indicator of protein-protein interaction

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse SCY_4732 to biotin ligase

    • Express in yeast cells and allow biotinylation of proximal proteins

    • Identify biotinylated proteins by streptavidin pulldown and mass spectrometry

These methodologies can help build an interaction network for SCY_4732 and provide insights into its functional role within the vacuolar membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.