Recombinant Saccharomyces cerevisiae Vacuolar membrane protein VIN13_4115 (VIN13_4115)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VIN13_4115; Vacuolar membrane protein VIN13_4115
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast)
Target Names
VIN13_4115
Target Protein Sequence
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDXRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII
Uniprot No.

Target Background

Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

What is VIN13_4115 and what is its functional significance in Saccharomyces cerevisiae?

VIN13_4115 is a vacuolar membrane protein found in Saccharomyces cerevisiae that appears to be associated with the vacuolar-type ATPase (V-ATPase) complex. V-ATPases are essential for numerous cellular processes including receptor-mediated endocytosis, protein maturation, and lysosomal/vacuolar acidification . The protein likely contributes to the proton translocation function of the V-ATPase complex, similar to other subunits such as Vph1p (vacuole-targeted) or Stv1p (Golgi and endosome-targeted) . In yeast, vacuolar proteins play critical roles in maintaining cellular homeostasis, stress responses, and nutrient storage, making VIN13_4115 potentially significant for yeast survival under various environmental conditions.

Which expression system is most suitable for producing recombinant VIN13_4115?

For expressing recombinant VIN13_4115, Saccharomyces cerevisiae itself serves as an excellent homologous expression system due to its native post-translational modification machinery. When working with this system, consider using either integrative or episomal vectors based on your research needs . For higher yields, Pichia pastoris (now Komagataella phaffii) may be preferred as it typically achieves higher expression levels for recombinant proteins . Both systems allow for proper protein folding and membrane integration critical for membrane proteins.

The choice depends on your specific experimental requirements:

Expression SystemAdvantagesDisadvantagesBest For
S. cerevisiaeNative environment, appropriate PTMs, EUROSCARF deletion strains available for optimizationLower yields compared to P. pastorisFunctional studies, interaction analyses
P. pastorisHigher expression levels, strong promoters (AOX1, GAP)More limited genetic toolsStructural studies requiring higher protein amounts
Mammalian cellsComplex glycosylation if neededExpensive, time-consumingStudies requiring mammalian-like modifications

Consider molecular factors such as codon optimization and signal sequence selection to improve expression efficiency .

What are the key challenges in purifying recombinant vacuolar membrane proteins like VIN13_4115?

Purifying vacuolar membrane proteins presents several significant challenges. Membrane proteins are inherently difficult to extract while maintaining their native conformation due to their hydrophobic transmembrane domains. For VIN13_4115, specific challenges include:

  • Solubilization: Identifying appropriate detergents that effectively extract the protein from membranes while preserving structural integrity. Detergents like DDM, LMNG, or GDN may be effective based on experiences with similar V-ATPase subunits .

  • Stability: Maintaining protein stability throughout purification, as membrane proteins often denature when removed from their lipid environment.

  • Lipid requirements: V-ATPase components often have specific lipid interactions crucial for function, as evidenced by the presence of bound lipids observed in cryo-EM structures of V-ATPase complexes .

  • Complex assembly: If studying the protein as part of the V-ATPase complex, maintaining the integrity of protein-protein interactions during purification can be challenging. The V1-VO connection can be particularly labile, as demonstrated in the case of Stv1p-containing complexes .

  • Yield limitations: Expression levels of membrane proteins are typically lower than soluble proteins, requiring optimization of growth conditions and extraction protocols.

A methodological approach to overcoming these challenges includes screening multiple detergents at varying concentrations, incorporating stabilizing lipids during purification, and utilizing fusion tags that enhance stability and facilitate purification.

How can I optimize the expression conditions for maximum yield of functional VIN13_4115?

Optimizing expression of recombinant VIN13_4115 requires a systematic approach addressing multiple factors affecting membrane protein production:

  • Strain Selection: Utilize engineered S. cerevisiae strains specifically designed for recombinant protein expression. The EUROSCARF collection of single gene deletion strains can be valuable for identifying genetic backgrounds that enhance production . Testing expression in strains with alterations in secretory pathway or vacuolar sorting machinery may improve yields.

  • Expression Vector Design: For optimal expression, consider the following elements:

    • Promoter selection: For constitutive expression, use the GPD or TEF1 promoters; for inducible expression, consider GAL1-10 promoters

    • Codon optimization: Adjust codon usage to match highly expressed yeast genes

    • Addition of fusion tags: N-terminal tags like His8 or FLAG can aid purification without disrupting membrane insertion

    • Signal sequences: Evaluate native vs. engineered signal sequences for optimal membrane targeting

  • Culture Conditions: Implement a Design of Experiments (DoE) approach to systematically test:

ParameterRange to TestMonitoring Method
Temperature20-30°CGrowth curves, protein yield quantification
Media compositionStandard vs. enrichedFinal OD, protein yield
pH5.0-7.0Growth, protein functionality
Induction timingEarly, mid, late log phaseProtein yield, quality
Aeration ratesLow, medium, highOxygen transfer rate, growth, yield
  • Post-translational modifications: If glycosylation is important for VIN13_4115 function, verify glycosylation patterns using mass spectrometry and consider humanized glycosylation strains if necessary for downstream applications .

  • Transcriptional profiling: Monitor gene expression changes during protein production to identify rate-limiting steps and potential bottlenecks, which can inform subsequent strain engineering approaches .

Implement iterative optimization cycles, focusing on factors showing the greatest impact on functional protein yield.

What structural analysis techniques are most effective for characterizing VIN13_4115?

Structural characterization of membrane proteins like VIN13_4115 requires specialized approaches:

  • Cryo-Electron Microscopy (Cryo-EM): This has become the method of choice for vacuolar ATPase components, as demonstrated by the successful determination of V-ATPase structures at 3.1-3.2Å resolution . For VIN13_4115, cryo-EM may reveal important structural features including:

    • Transmembrane domain organization

    • Lipid binding sites

    • Protein-protein interaction interfaces

    • Conformational states

  • X-ray Crystallography: Though challenging for membrane proteins, this approach can provide high-resolution structural details if diffracting crystals can be obtained. Success often depends on:

    • Protein stability in detergent micelles

    • Lipid cubic phase crystallization methods

    • Use of antibody fragments to stabilize protein conformation

  • Nuclear Magnetic Resonance (NMR): Suitable for analyzing specific domains or protein-ligand interactions, particularly for smaller protein fragments.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Valuable for mapping dynamic regions and conformational changes in response to different conditions.

  • Molecular Dynamics Simulations: Computational analysis to predict protein behavior in membrane environments and identify potential functional motifs.

For comprehensive structural characterization, combine multiple techniques:

  • Initial low-resolution structural characterization via negative-stain EM

  • High-resolution structure determination via cryo-EM

  • Functional validation of structural findings through mutagenesis studies

  • Computational modeling to predict dynamics and interactions

When preparing samples for structural studies, maintain bound lipids as they may be essential for structural integrity, similar to observations in other V-ATPase components where regularly spaced densities corresponding to lipids or ergosterol were observed around protein complexes .

How do I troubleshoot when my VIN13_4115 recombinant protein shows inconsistent activity levels?

Inconsistent activity of recombinant VIN13_4115 can stem from multiple sources. Follow this systematic troubleshooting approach:

  • Verify protein integrity:

    • Check for proteolytic degradation using western blotting with antibodies targeting different protein regions

    • Perform mass spectrometry to confirm full-length protein sequence

    • Assess protein homogeneity using size-exclusion chromatography

  • Evaluate protein folding and conformation:

    • Use circular dichroism spectroscopy to analyze secondary structure elements

    • Consider limited proteolysis assays to assess conformational stability

    • Apply fluorescence-based thermal shift assays to evaluate protein stability

  • Assess lipid requirements:

    • V-ATPase components often require specific lipids for activity, as evidenced by bound lipids observed in cryo-EM structures

    • Supplement activity assays with various lipids (phosphatidylserine, phosphatidylinositol, ergosterol) to identify cofactors

  • Check for interacting partners:

    • Determine if VIN13_4115 requires association with other V-ATPase components for full activity

    • Consider co-expression with interacting subunits if necessary

  • Optimize assay conditions:

    • Systematically vary buffer components, pH, and ionic strength

    • Test different detergents or nanodiscs for maintaining membrane environment

    • Develop a standardized protocol with appropriate positive and negative controls

  • Address expression heterogeneity:

    • If using integrative vectors in yeast, transformants often exhibit heterogeneous expression levels requiring screening of many colonies

    • Consider FACS-based sorting to isolate high-expressing populations

    • Implement clonal selection and validation protocols

Document all troubleshooting steps and outcomes to establish a consistent protocol for future work.

How should I address contradictory results when comparing my VIN13_4115 findings with published literature?

When facing contradictory results between your VIN13_4115 research and published literature, employ a structured approach to resolve discrepancies :

  • Verify Data and Methodology:

    • Re-examine raw data and experimental protocols for potential errors

    • Confirm reagent quality, including antibody specificity and recombinant protein purity

    • Check for differences in strain backgrounds, as S. cerevisiae strains can vary significantly

  • Review Methodological Differences:

    • Identify variations in experimental conditions that might explain discrepancies

    • Pay particular attention to protein purification methods, as membrane proteins are sensitive to extraction conditions

    • Note differences in activity assay compositions, especially regarding lipid content

  • Check Assumptions and Definitions:

    • Clarify how activity is defined and measured across studies

    • Consider whether different protein isoforms or splice variants might be involved

    • Evaluate whether post-translational modifications are consistently present

  • Statistical Analysis:

    • Re-analyze data using appropriate statistical methods

    • Consider sample size limitations and statistical power

    • Determine whether differences are statistically significant or within expected variation

  • Collaborative Resolution:

    • Contact authors of contradictory publications to discuss findings

    • Consider collaborative experiments to resolve discrepancies

    • Present alternative hypotheses that might reconcile conflicting results

  • Contextual Factors:

    • Examine how environmental conditions might influence protein behavior

    • Consider differences in protein complex assembly or subcellular localization

    • Evaluate whether contradictions might represent genuine biological variability

Document your analysis process thoroughly, as resolving contradictions often leads to important new insights about protein function and regulation.

What are the most effective methods for analyzing VIN13_4115 protein-protein interactions in the V-ATPase complex?

Analyzing protein-protein interactions for VIN13_4115 within the V-ATPase complex requires specialized approaches for membrane protein complexes:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS):

    • Tag VIN13_4115 with affinity tags (FLAG, His, etc.)

    • Perform gentle solubilization using appropriate detergents

    • Identify interacting partners through LC-MS/MS

    • Validate specific interactions using reciprocal pull-downs

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Perform proteomic analysis to identify crosslinked peptides

    • Map interaction interfaces at amino acid resolution

    • This approach has been successful with other V-ATPase components

  • Proximity Labeling:

    • Fuse VIN13_4115 to enzymes like BioID or APEX2

    • Allow proximity-dependent labeling of neighboring proteins

    • Identify labeled proteins through streptavidin pull-down and MS

    • This approach works in native cellular environments

  • Co-immunoprecipitation Studies:

    • Similar to approaches used for DNM2-NME interactions in case study 2 , develop specific antibodies against VIN13_4115

    • Perform two-way co-immunoprecipitations to validate interactions

    • Use western blotting to detect specific interacting partners

  • Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC):

    • Generate fluorescent protein fusions

    • Analyze protein interactions in live cells

    • Quantify interaction strength and dynamics

For comprehensive interaction mapping, combine multiple complementary approaches and validate key interactions through functional assays, such as activity measurements and mutagenesis studies.

What expression vector systems are recommended for producing recombinant VIN13_4115 in yeast?

Selecting appropriate expression vectors is critical for successful production of recombinant VIN13_4115 in yeast:

For Saccharomyces cerevisiae:

  • Episomal Plasmids (YEp-based):

    • High copy number provides potentially higher expression

    • Examples include pRS42x series with 2μ origin

    • Suitable for initial expression testing and optimization

    • May show plasmid instability without selection pressure

  • Integrative Plasmids (YIp-based):

    • Single or multiple integration into yeast genome

    • More stable expression without selection pressure

    • Examples include pRS30x/40x series

    • Integration can target specific genomic loci using homologous recombination

  • Centromeric Plasmids (YCp-based):

    • Low copy number (1-2 copies per cell)

    • More stable than 2μ plasmids

    • Useful when protein overexpression causes toxicity

Vector features to consider include:

  • Promoter options: constitutive (GPD, TEF1) or inducible (GAL1, CUP1)

  • Selection markers: auxotrophic (URA3, LEU2, HIS3, TRP1) or antibiotic (kanMX, hphMX)

  • Epitope tags: His6/His8, FLAG, myc, HA, GFP

For Pichia pastoris:

  • Integrative Vectors:

    • pPIC series for methanol-inducible expression (AOX1 promoter)

    • pGAPZ series for constitutive expression (GAP promoter)

    • Targeted integration at specific genomic loci

When working with P. pastoris, be aware that transformants often exhibit heterogeneous expression levels, necessitating screening of multiple colonies to identify high producers .

For VIN13_4115 specifically, consider vectors with strong promoters but incorporate an inducible system to control expression levels if toxicity becomes an issue during overexpression.

How can I develop reliable functional assays for VIN13_4115 activity?

Developing functional assays for VIN13_4115 requires understanding its role within the V-ATPase complex. Based on its similarity to other vacuolar membrane proteins, consider these methodological approaches:

For all functional assays, establish appropriate positive and negative controls, determine the linear range of the assay, and ensure reproducibility across multiple protein preparations.

What are the best practices for analyzing post-translational modifications of VIN13_4115?

Post-translational modifications (PTMs) can significantly impact vacuolar membrane protein function. To comprehensively analyze PTMs in VIN13_4115:

  • Mass Spectrometry-Based Approaches:

    • Employ high-resolution LC-MS/MS for identification and site mapping

    • Use multiple proteases (trypsin, chymotrypsin, Glu-C) to improve sequence coverage

    • Apply enrichment strategies for specific modifications:

      • Phosphorylation: TiO2, IMAC, phospho-antibodies

      • Glycosylation: Lectin affinity, hydrazide chemistry

      • Ubiquitination: Ubiquitin remnant antibodies

  • Site-Directed Mutagenesis Validation:

    • Mutate identified PTM sites to non-modifiable residues

    • Assess functional consequences through activity assays

    • Evaluate effects on protein localization and stability

  • Temporal Dynamics Analysis:

    • Monitor changes in modification patterns under different conditions

    • Assess modification status during protein trafficking

    • Study regulation during stress responses

  • Modification-Specific Detection Methods:

    • Develop or use available modification-specific antibodies

    • Apply specific staining techniques for glycan detection

    • Use PhosTag gels for phosphorylation analysis

  • Structural Impact Assessment:

    • Correlate modification sites with structural elements

    • Model the effect of PTMs on protein conformation

    • Analyze potential regulation of protein-protein interactions

When identifying glycosylation patterns, consider that S. cerevisiae typically produces high-mannose type N-glycans, which can influence protein folding and trafficking. For membrane proteins, phosphorylation often regulates trafficking, localization, or protein-protein interactions.

How can VIN13_4115 research contribute to understanding vacuolar acidification mechanisms?

Research on VIN13_4115 can significantly advance our understanding of vacuolar acidification mechanisms through several approaches:

  • Comparative Analysis with Known V-ATPase Components:

    • Analyze functional differences between VIN13_4115 and characterized components like Vph1p and Stv1p

    • Determine whether VIN13_4115 shows compartment-specific targeting similar to these isoforms

    • Assess whether it confers specific regulatory properties to the V-ATPase complex

  • Structure-Function Relationships:

    • Map the proton translocation pathway through the protein complex

    • Identify residues critical for proton coordination and transport

    • Determine how structural elements contribute to coupling ATP hydrolysis with proton movement

  • Regulatory Mechanisms:

    • Investigate how VIN13_4115 responds to cellular signaling events

    • Determine whether it undergoes reversible dissociation from the V-ATPase complex

    • Assess its role in glucose-dependent regulation of V-ATPase assembly

  • Environmental Response:

    • Examine how VIN13_4115 function changes under various stress conditions

    • Characterize its role in adapting to pH, osmotic, or nutritional stress

    • Determine whether its expression or modification state changes during stress responses

  • Evolutionary Conservation:

    • Compare VIN13_4115 with homologs in other organisms

    • Identify conserved functional motifs and species-specific adaptations

    • Relate structural features to evolutionary conservation patterns

This research has broader implications for understanding fundamental mechanisms of cellular pH homeostasis, nutrient sensing, and stress adaptation in eukaryotes.

What are the recommended approaches for analyzing VIN13_4115 lipid interactions?

Analyzing lipid interactions of VIN13_4115 is crucial since V-ATPase components often show specific lipid requirements for function. Based on observations of lipid interactions in related proteins , consider these methodological approaches:

  • Lipidomic Analysis of Co-purifying Lipids:

    • Extract and analyze lipids that co-purify with VIN13_4115

    • Use LC-MS/MS to determine lipid species composition

    • Compare endogenous lipid profiles with functional activity

    • Quantify binding affinities for different lipid classes

  • Protein Reconstitution in Defined Lipid Environments:

    • Prepare liposomes or nanodiscs with controlled lipid composition

    • Systematically vary lipid components to identify those critical for function

    • Measure activity parameters in different lipid environments

    • Assess how specific lipids affect protein stability

  • Cryo-EM Analysis of Lipid Binding Sites:

    • Identify density features corresponding to bound lipids

    • Map lipid binding sites on the protein structure

    • Analyze how lipids contribute to protein complex stability

    • Observe regularly spaced densities that may correspond to ergosterol or other lipids

  • Molecular Dynamics Simulations:

    • Model protein-lipid interactions in silico

    • Identify potential lipid binding pockets

    • Simulate how lipid binding affects protein dynamics

    • Predict functional consequences of lipid-protein interactions

  • Chemical Crosslinking of Protein-Lipid Interactions:

    • Use photoactivatable lipid analogs to capture transient interactions

    • Identify crosslinked lipid-peptide adducts by mass spectrometry

    • Map lipid binding sites at amino acid resolution

When analyzing results, consider that specific lipids may play both structural and regulatory roles, potentially influencing protein conformation, complex assembly, or catalytic activity.

How do I design experiments to investigate VIN13_4115's role in stress response pathways?

To investigate VIN13_4115's role in stress response pathways, design experiments that systematically probe its function under various stress conditions:

  • Gene Deletion and Complementation Analysis:

    • Generate VIN13_4115 knockout strains in S. cerevisiae

    • Perform phenotypic analysis under multiple stress conditions:

      • Acid/alkaline pH

      • Osmotic stress

      • Nutrient limitation

      • Temperature stress

      • Oxidative stress

    • Complement with wild-type and mutant variants

    • Quantify growth rates, survival, and recovery kinetics

  • Transcriptional and Translational Regulation:

    • Analyze VIN13_4115 mRNA levels under stress conditions

    • Determine protein abundance changes using quantitative proteomics

    • Assess post-translational modification patterns during stress

    • Identify transcription factors regulating VIN13_4115 expression

  • Protein Localization and Trafficking:

    • Generate fluorescent protein fusions to track localization

    • Monitor dynamic changes in response to stress signals

    • Assess co-localization with stress response markers

    • Determine whether VIN13_4115 undergoes stress-induced relocalization

  • Interaction Partner Dynamics:

    • Identify stress-specific interaction partners using proximity labeling

    • Determine how protein complex composition changes during stress

    • Assess V-ATPase complex assembly/disassembly kinetics

    • Map interaction networks under normal versus stress conditions

  • Vacuolar pH and Function Measurements:

    • Monitor vacuolar pH using ratiometric fluorescent probes

    • Assess vacuolar fragmentation/fusion dynamics during stress

    • Measure vacuolar enzyme activities as functional readouts

    • Quantify stress-induced changes in vacuolar morphology

Design your experiments with appropriate controls, including known vacuolar stress response mutants, and ensure statistical rigor through sufficient biological and technical replicates.

What statistical approaches are most appropriate for analyzing VIN13_4115 experimental data?

  • For Activity Assays and Functional Measurements:

    • Descriptive statistics: Mean, median, standard deviation, standard error

    • Inferential statistics: t-tests for pairwise comparisons, ANOVA with post-hoc tests for multiple conditions

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if data doesn't meet normality assumptions

    • Regression analysis for dose-response relationships

  • For High-Throughput Omics Data:

    • Apply appropriate normalization methods based on data type

    • Use multiple testing correction (Benjamini-Hochberg, Bonferroni) to control false discovery rate

    • Consider dimension reduction techniques (PCA, t-SNE) for visualization

    • Implement appropriate bioinformatic pipelines for proteomics or transcriptomics data

  • For Kinetic Measurements:

    • Fit data to appropriate mathematical models (Michaelis-Menten, allosteric models)

    • Use non-linear regression to extract kinetic parameters

    • Apply statistical comparisons of fitted parameters across conditions

    • Consider global fitting approaches for complex datasets

  • For Reproducibility Assessment:

    • Calculate coefficients of variation for technical and biological replicates

    • Implement power analysis to determine appropriate sample sizes

    • Use Bland-Altman plots to assess agreement between methods

    • Report effect sizes alongside p-values

  • For Imaging and Localization Data:

    • Apply quantitative image analysis methods

    • Use colocalization statistics (Pearson's correlation, Manders' coefficients)

    • Implement object-based analyses for discrete structures

    • Consider machine learning approaches for complex pattern recognition

When reporting results, follow best practices :

  • Clearly state statistical tests used

  • Report exact p-values rather than ranges

  • Include measures of effect size

  • Provide transparent access to raw data when possible

How should I present contradictory or unexpected findings about VIN13_4115?

When presenting contradictory or unexpected findings about VIN13_4115, adopt a transparent and rigorous approach :

  • Acknowledge the Contradiction Directly:

    • Present both your findings and existing literature objectively

    • Clearly state the nature and extent of the discrepancy

    • Avoid downplaying or overemphasizing contradictions

  • Document Methodological Differences:

    • Create comparative tables highlighting methodological variations

    • Detail differences in:

      • Strains and genetic backgrounds

      • Protein purification approaches

      • Assay conditions and reagents

      • Data analysis methods

  • Present Alternative Hypotheses:

    • Propose plausible explanations for the contradictions

    • Discuss biological mechanisms that might reconcile differing results

    • Consider whether contradictions reveal new aspects of protein function

  • Validate Through Multiple Approaches:

    • Strengthen unexpected findings with complementary methods

    • Present results from independent experimental approaches

    • Show replication across different conditions or systems

  • Visual Presentation of Data:

    • Use clear, transparent data visualization that shows raw data points

    • Implement appropriate error bars and statistical analyses

    • Consider graphical abstracts to illustrate competing models

    • Present side-by-side comparisons of your results with previous findings

  • Discuss Limitations Openly:

    • Acknowledge constraints of your experimental approach

    • Discuss potential sources of variability or error

    • Propose future experiments to resolve remaining questions

Remember that unexpected findings often lead to important scientific advances, so present contradictions as opportunities for deeper understanding rather than problems to be minimized.

What are the best practices for visualizing VIN13_4115 structural and functional data?

Effective visualization of VIN13_4115 structural and functional data enhances communication of complex findings :

When preparing visualizations, prioritize clarity over complexity, ensure accessibility (consider color-blind friendly palettes), maintain consistent scales across comparable figures, and provide detailed figure legends explaining all elements.

How can CRISPR-Cas9 genome editing be optimized for studying VIN13_4115?

CRISPR-Cas9 offers powerful approaches for studying VIN13_4115 function in its native genomic context:

  • Gene Knockout Strategies:

    • Design guide RNAs targeting multiple regions of the VIN13_4115 gene

    • Implement scarless deletion strategies using repair templates

    • Consider inducible knockout systems for essential functions

    • Create libraries of knockout strains in different genetic backgrounds

  • Precise Genetic Modification:

    • Engineer point mutations to study specific functional residues

    • Create domain deletions or swaps to assess structural contributions

    • Introduce epitope tags or fluorescent protein fusions at the endogenous locus

    • Implement base editing or prime editing for precise modifications

  • Regulatable Expression Systems:

    • Replace native promoters with inducible or repressible promoters

    • Create degron-tagged versions for rapid protein depletion

    • Implement transcriptional or translational control elements

    • Design allelic series with varying expression levels

  • High-Throughput Functional Genomics:

    • Create tiling sgRNA libraries targeting the entire gene

    • Develop pooled CRISPR screens with growth or fluorescence readouts

    • Implement CRISPR activation or interference to modulate expression

    • Design saturation mutagenesis libraries for deep mutational scanning

  • Optimization for S. cerevisiae:

    • Select appropriate Cas9 expression systems (constitutive or inducible)

    • Optimize sgRNA design using yeast-specific algorithms

    • Consider co-expression of DNA repair factors to enhance homologous recombination

    • Implement efficient transformation protocols for CRISPR components

When designing CRISPR experiments, verify editing efficiency through sequencing, validate phenotypes with complementation assays, and consider potential off-target effects through whole-genome sequencing of edited strains.

What emerging technologies might advance VIN13_4115 research in the next five years?

Several emerging technologies are poised to revolutionize research on vacuolar membrane proteins like VIN13_4115:

  • Cryo-Electron Tomography (Cryo-ET):

    • Visualize VIN13_4115 in its native cellular environment

    • Study macromolecular complexes in situ at near-atomic resolution

    • Observe conformational states under physiological conditions

    • Map spatial organization within vacuolar membranes

  • AI-Enhanced Structural Prediction:

    • Leverage AlphaFold2 and similar tools for structure prediction

    • Predict protein-protein interaction interfaces

    • Model conformational dynamics and functional states

    • Design rational mutations based on predicted structures

  • Single-Molecule Techniques:

    • Apply single-molecule FRET to study conformational changes

    • Use high-speed AFM to observe protein dynamics in membranes

    • Implement optical tweezers or magnetic tweezers for force measurements

    • Develop single-molecule electrophysiology for transport studies

  • Advanced Mass Spectrometry:

    • Native MS for intact membrane protein complexes

    • Hydrogen-deuterium exchange MS for conformational dynamics

    • Top-down proteomics for complete protein characterization

    • Spatial MS for in situ protein analysis

  • Genome-Scale Metabolic Modeling:

    • Integrate VIN13_4115 function into whole-cell models

    • Predict system-level effects of protein modifications

    • Simulate metabolic responses to vacuolar dysfunction

    • Design synthetic biology applications based on model predictions

  • Microfluidics and Organ-on-a-Chip:

    • Study VIN13_4115 function under precise environmental control

    • Implement high-throughput screening platforms

    • Create artificial vacuolar systems to study isolated functions

    • Develop continuous monitoring of protein activity

As these technologies mature, they will enable more comprehensive understanding of VIN13_4115's structure, function, and regulation in both normal physiology and disease states.

How can I integrate multi-omics approaches to better understand VIN13_4115 function?

Integrating multi-omics approaches provides a comprehensive understanding of VIN13_4115 function within cellular networks:

  • Study Design for Multi-Omics Integration:

    • Collect samples for multiple omics analyses from the same experimental setup

    • Include appropriate time points to capture dynamic processes

    • Design controlled perturbations (gene knockout, stress conditions)

    • Ensure sufficient biological replicates for statistical power

  • Complementary Omics Technologies:

    • Genomics: Identify genetic variants affecting VIN13_4115 function

    • Transcriptomics: Assess gene expression changes in response to VIN13_4115 perturbation

    • Proteomics: Quantify protein abundance and post-translational modifications

    • Metabolomics: Measure metabolic consequences of altered vacuolar function

    • Lipidomics: Characterize membrane composition effects on protein function

    • Interactomics: Map protein-protein interaction networks

  • Data Integration Strategies:

    • Implement correlation networks across omics layers

    • Apply machine learning for pattern recognition

    • Develop causal network models to infer regulatory relationships

    • Use pathway enrichment analysis to identify affected biological processes

  • Visualization of Integrated Data:

    • Create multi-layer network visualizations

    • Implement interactive dashboards for data exploration

    • Develop circular plots showing connections between omics layers

    • Use dimensionality reduction to visualize global patterns

  • Functional Validation of Multi-Omics Findings:

    • Select key predictions for experimental validation

    • Design targeted assays to test specific hypotheses

    • Implement iterative cycles of prediction and validation

    • Use CRISPR screens to test multiple candidates in parallel

This integrated approach allows for:

  • Identification of regulatory networks controlling VIN13_4115 expression

  • Discovery of metabolic pathways affected by VIN13_4115 function

  • Understanding compensatory mechanisms in response to protein perturbation

  • Placing VIN13_4115 function in the broader context of cellular homeostasis

Effective integration requires careful experimental design, appropriate computational tools, and cross-disciplinary expertise in both data analysis and yeast biology.

What are the most significant unresolved questions about VIN13_4115?

Despite advances in vacuolar membrane protein research, several critical questions about VIN13_4115 remain unresolved:

  • Structural and Functional Specificity:

    • How does VIN13_4115's structure differ from other vacuolar membrane proteins?

    • What unique functional properties does it confer to the V-ATPase complex?

    • Does it have specialized roles in specific cellular processes beyond general vacuolar function?

  • Regulatory Mechanisms:

    • How is VIN13_4115 expression and activity regulated at transcriptional and post-translational levels?

    • What signaling pathways modulate its function?

    • How does its regulation differ across growth phases and stress conditions?

  • Protein-Lipid Interactions:

    • Which specific lipids are essential for VIN13_4115 function?

    • How do membrane microdomains influence its localization and activity?

    • Are there regulatory lipids that modulate its conformation or interactions?

  • Evolutionary Conservation and Adaptation:

    • How conserved is VIN13_4115 across fungal species and beyond?

    • What structural features have been maintained or diverged through evolution?

    • Do homologs in pathogenic fungi offer potential therapeutic targets?

  • Integration with Cellular Metabolism:

    • How does VIN13_4115 function coordinate with broader metabolic networks?

    • What is its role in nutrient sensing and metabolic adaptation?

    • How does it contribute to cellular energy homeostasis?

Addressing these questions will require interdisciplinary approaches combining structural biology, systems biology, and evolutionary analysis. The answers will advance both fundamental understanding of vacuolar function and potential applications in biotechnology and medicine.

How can researchers effectively collaborate across disciplines to advance VIN13_4115 research?

Advancing VIN13_4115 research requires effective cross-disciplinary collaboration:

  • Establish Common Language and Goals:

    • Develop shared terminology across disciplines

    • Clearly define research questions with input from all collaborators

    • Create a unified conceptual framework that bridges different perspectives

    • Establish realistic timelines and milestones

  • Leverage Complementary Expertise:

    • Combine structural biologists, biochemists, cell biologists, and computational scientists

    • Integrate experimental and theoretical approaches

    • Incorporate both specialists in yeast biology and experts in general membrane protein function

    • Involve data scientists for complex analysis and modeling

  • Implement Integrated Workflows:

    • Design experiments that generate data useful for multiple disciplines

    • Establish sample sharing and standardized protocols

    • Create data management plans accessible to all collaborators

    • Develop analysis pipelines that support interdisciplinary interpretation

  • Effective Communication Structures:

    • Schedule regular cross-disciplinary meetings

    • Implement collaborative tools for real-time data sharing

    • Create visualization methods accessible to researchers from all backgrounds

    • Establish clear authorship and credit guidelines early

  • Training and Knowledge Transfer:

    • Organize workshops to share specialized techniques

    • Develop cross-training opportunities for team members

    • Create accessible resources explaining discipline-specific concepts

    • Encourage rotation of researchers between different labs

  • Collaborative Funding Strategies:

    • Target interdisciplinary grant mechanisms

    • Develop proposals highlighting synergistic benefits

    • Create resource-sharing agreements across institutional boundaries

    • Establish core facilities that support multiple research directions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.