Saccharomyces cerevisiae, commonly known as baker's yeast, is a widely studied eukaryotic organism in the field of molecular biology and genetics. Vacuoles, essential organelles in yeast cells, perform functions including storage, degradation, and maintenance of cellular turgor. Vacuolar membrane proteins, such as VL3_4134, play critical roles in these processes . VL3_4134 is a protein found in the vacuolar membrane of S. cerevisiae .
The VL3_4134 gene encodes a polypeptide of 314 amino acids . The protein lacks an N-terminal methionine and a cleavable signal sequence . The recombinant protein often includes a His-tag, facilitating purification and detection .
The amino acid sequence of VL3_4134 is as follows :
MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA
TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR
RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS
PFNPIQDPFTDXRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE
ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP
SMFLDDVLNGREII
The precise function of VL3_4134 is not yet fully understood, research suggests potential roles in vacuolar processes :
Vacuolar Acidification: VL3_4134 may be associated with vacuolar membrane H(+)-ATPase activity, which is crucial for maintaining the acidic environment within the vacuole .
Protein Transport: VL3_4134 may play a role in protein transport to the vacuole . Disruption of related genes can cause lesions in vacuolar biogenesis and protein transport .
Amino Acid Transport: VL3_4134 may be involved in the transport of amino acids across the vacuolar membrane . Homologues like Avt3p in S. cerevisiae mediate the extrusion of amino acids from the vacuolar lumen into the cytosol .
Vacuolar Fragmentation: VL3_4134 may influence vacuole fragmentation, a process involving membrane dynamics and fission .
Common experimental approaches used to study VL3_4134 include:
Recombinant Expression: Expressing the protein in E. coli with a His-tag for purification .
Mutant Studies: Creating and analyzing mutants with disruptions in the VL3_4134 gene to understand its function .
Localization Studies: Using GFP-tagged VL3_4134 to observe its localization within the cell .
Biochemical Assays: Measuring vacuolar ATPase activity and protein transport capabilities in mutant strains .
In vivo screening: Screening deletion mutants for deficiencies in vacuolar fragmentation activity .
While specific applications for VL3_4134 are still under investigation, understanding its role may have implications for:
Biotechnology: Enhancing yeast strains for industrial applications, such as biofuel production and protein synthesis .
Drug Discovery: Identifying potential drug targets related to vacuolar function and cellular health.
Basic Research: Expanding knowledge of membrane protein function and cellular dynamics in eukaryotic cells .
Recombinant VL3_4134 should be stored at -20°C/-80°C, with an expected shelf life of 6 months for liquid formulations and 12 months for lyophilized forms. For working aliquots, storage at 4°C for up to one week is recommended. Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For lyophilized powder, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage .
For optimal reconstitution:
Briefly centrifuge the vial to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (the default recommendation is 50%)
Recombinant VL3_4134 can be produced using multiple expression systems:
| Expression System | Product Code Example | Notes |
|---|---|---|
| E. coli | CSB-EP520693SVR1 | Most commonly used system |
| Yeast | CSB-YP520693SVR1 | Native environment expression |
| Baculovirus | CSB-BP520693SVR1 | For eukaryotic post-translational modifications |
| Mammalian cell | CSB-MP520693SVR1 | For complex eukaryotic modifications |
The choice depends on the research requirements regarding protein folding, post-translational modifications, and experimental applications .
To study VL3_4134 localization:
Fluorescence microscopy techniques: Using GFP-fusion constructs similar to those used for studying Vph1-GFP distribution. This allows visualization of protein distribution across different domains of the vacuolar membrane under various conditions .
Freeze-fracture electron microscopy (EM): This technique has been used to observe vacuolar membrane domain segregation, showing intramembrane particle (IMP)-rich and IMP-deficient domains. This approach would be valuable for determining if VL3_4134 localizes to specific membrane domains .
Co-localization studies: Using fluorescent markers for different membrane domains (e.g., Fast DiI which has higher affinity for liquid-disordered (Ld) phases) to determine the phase preference of VL3_4134 .
Immunogold labeling with electron microscopy: For high-resolution localization studies, particularly to determine if VL3_4134 localizes to membrane invaginations .
Based on studies of other vacuolar membrane proteins, VL3_4134 may participate in the formation of microdomains on the vacuolar membrane through phase separation processes. Research has shown that vacuolar membranes can segregate into different domains, particularly under stress conditions like heat shock or during stationary phase.
The methodological approach to investigate this would include:
Observe VL3_4134-GFP distribution patterns under normal conditions versus stress conditions
Use lipid dyes like Fast DiI to determine if VL3_4134 preferentially localizes to specific lipid phases
Compare distribution patterns with known domain-forming proteins like Vph1, Zrc1, or Ybt1
Analyze the amino acid sequence for motifs that might target it to specific membrane domains
Create deletion mutants to identify regions responsible for domain localization
Vacuolar membrane invaginations are critical structures that form under stress conditions. To investigate VL3_4134's role:
Generate VL3_4134 deletion mutants and observe vacuolar morphology changes under stress conditions
Compare the phenotype with other mutants known to affect invagination (e.g., hfl1Δ, atg8Δ, ivy1Δ)
Test genetic interactions by creating double mutants (e.g., VL3_4134Δ/hfl1Δ or VL3_4134Δ/ivy1Δ)
Determine if VL3_4134 localizes to the neck of invaginations using high-resolution microscopy
Examine the function of ESCRT machinery in VL3_4134 mutants since ESCRT is necessary for invagination formation
These approaches would help determine if VL3_4134 functions similarly to Hfl1, which localizes to invagination necks and suppresses excessive invaginations, or if it has a distinct role in vacuolar dynamics .
The ESCRT (Endosomal Sorting Complex Required for Transport) machinery is necessary for forming vacuolar invaginations. To study potential interactions with VL3_4134:
Create double mutants between VL3_4134 and ESCRT components (e.g., VL3_4134Δ/vps23Δ, VL3_4134Δ/vps24Δ, VL3_4134Δ/vps4Δ)
Perform epistasis analysis to determine the genetic relationship
Conduct co-immunoprecipitation experiments to test for physical interactions
Use fluorescence microscopy to determine if VL3_4134 co-localizes with ESCRT components during invagination formation
Based on studies with other vacuolar proteins, if ESCRT mutations are epistatic to VL3_4134 mutations (as they are to hfl1Δ and atg8Δ), this would suggest that VL3_4134 functions upstream of the ESCRT machinery in the regulation of vacuolar dynamics .
When investigating VL3_4134's role in heat stress response, consider this experimental design approach:
Define variables:
Independent variable: Heat stress conditions (e.g., 40.5°C for 2.5 hours)
Dependent variable: VL3_4134 localization, vacuolar morphology, or cell survival metrics
Controls: Wild-type cells, known vacuolar protein mutants (hfl1Δ, atg8Δ)
Formulate testable hypotheses:
H0: VL3_4134 distribution does not change under heat stress
H1: VL3_4134 redistributes to specific membrane domains under heat stress
Design treatments:
Vary heat stress intensity (37°C, 40.5°C, 42°C)
Vary duration (30min, 1h, 2.5h, 5h)
Include recovery periods at normal temperature
Group assignment:
Between-subjects design comparing different yeast strains
Within-subjects design comparing the same strain under different conditions
Measurement methods:
Fluorescence microscopy for protein localization
Electron microscopy for membrane structure analysis
Cell viability assays for functional consequences
This systematic approach follows established experimental design principles and will provide robust data on VL3_4134's stress response functions.
When analyzing VL3_4134 localization data, consider these statistical approaches:
For microscopy quantification:
Use intensity profile analysis across membrane sections
Calculate coefficient of variation for intensity distribution
Determine percentage of protein in different membrane domains
For comparing multiple experimental conditions:
ANOVA for comparing multiple groups, followed by appropriate post-hoc tests
Use non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated
For correlation analyses:
Pearson correlation for relationships between VL3_4134 distribution and other quantitative variables
Multiple regression for identifying key predictors of localization patterns
For time-course experiments:
Repeated measures ANOVA
Mixed effects models to account for random variation between samples
Sample size considerations:
Power analysis based on effect sizes from pilot experiments
Typically analyze >100 cells per condition to account for cell-to-cell variability
These approaches ensure robust statistical inference while controlling for Type I and Type II errors .
Vacuole size correlates with cell size, and vacuolar expansion is linked to cell growth. To investigate VL3_4134's potential role:
Create VL3_4134 deletion or overexpression strains and measure:
Cell size distribution
Vacuolar volume (using 3D modeling and quantitative analysis)
Growth rates under different conditions
Determine if VL3_4134 affects vacuolar occupancy (the proportion of cellular space occupied by the vacuole)
Examine potential interactions with the actin cytoskeleton, as some vacuolar membrane proteins connect to actin filaments through NET family proteins
Test if VL3_4134 expression correlates with expression of aquaporins (e.g., γ-TIP) that enable water uptake by the vacuole
If VL3_4134 regulates vacuolar expansion, genetic manipulation would be expected to alter both vacuolar and cellular size parameters, potentially affecting growth rates, particularly under stress conditions .
Vps1 protein plays a crucial role in the retention of Golgi membrane proteins and the formation of vesicles that transport proteins to the prevacuolar compartment. To investigate potential interactions with VL3_4134:
Create VL3_4134Δ/vps1Δ double mutants and observe vacuolar morphology and protein trafficking
Track VL3_4134 localization in vps1Δ cells to determine if its trafficking to the vacuole is affected
Design pulse-chase experiments to follow newly synthesized VL3_4134 in wild-type versus vps1Δ cells
Use temperature-sensitive vps1 mutants combined with VL3_4134 fluorescent tagging to observe trafficking routes
Perform protease digestion assays to determine if VL3_4134 appears on the plasma membrane in vps1Δ cells
These experiments would reveal whether VL3_4134 trafficking depends on the Vps1-mediated Golgi-to-vacuole pathway or if it follows an alternative route to the vacuolar membrane .
When facing contradictory data on VL3_4134 function:
Standardize experimental conditions:
Control for yeast strain backgrounds (laboratory vs. industrial strains)
Standardize growth media and conditions
Use identical stress parameters and duration
Validate with multiple methodologies:
Combine genetic, biochemical, and imaging approaches
Use both tagged and untagged versions of the protein
Verify key findings with different expression systems
Perform epistasis analysis:
Create double mutants with genes in potentially related pathways
Determine genetic hierarchies to place VL3_4134 in functional networks
Consider context-dependent functions:
Test function under multiple stress conditions
Examine cell-cycle dependent effects
Investigate nutrient-dependent regulation
Analyze protein isoforms and modifications:
Identify potential post-translational modifications
Examine if different experimental systems produce variants
This systematic approach helps resolve apparent contradictions by identifying condition-specific functions or technical variables affecting experimental outcomes .
Research on VL3_4134 may provide insights into several fundamental aspects of membrane biology:
Membrane domain formation: Studying how VL3_4134 distributes between different membrane domains can elucidate mechanisms of phase separation in biological membranes and how proteins sort to these domains.
Membrane curvature regulation: If VL3_4134 is involved in vacuolar invaginations, it may reveal mechanisms of membrane deformation and stabilization of highly curved membranes.
Organelle size control: VL3_4134's potential role in vacuolar size regulation would contribute to understanding how cells control organelle dimensions to match cellular needs.
Stress-induced membrane reorganization: By examining how heat and other stresses affect VL3_4134 distribution, researchers can understand general principles of how membranes adapt to environmental challenges .
To assess VL3_4134's potential applications:
For diagnostic applications:
Develop antibodies against VL3_4134 with high specificity
Create quantitative assays (ELISA, RT-PCR) to detect expression levels
Test if expression correlates with specific yeast strains or conditions
Perform comparative analysis with human proteins (if homologs exist)
For biotechnological applications:
Test if VL3_4134 manipulation affects stress tolerance in industrial yeast strains
Determine if VL3_4134 alterations improve protein production in yeast expression systems
Explore if VL3_4134's membrane-organizing properties could be utilized in synthetic biology applications
Investigate if VL3_4134 homologs in pathogenic fungi could be drug targets
These approaches would require rigorous validation across multiple experimental systems and extensive comparative analysis .
Current limitations include:
Membrane protein purification challenges:
Maintaining native structure during extraction from lipid environment
Achieving sufficient purity without aggregation
Preserving functional activity outside cellular context
Visualization constraints:
Resolution limits for studying dynamic membrane processes
Potential artifacts from fluorescent protein tags
Challenges in correlating fluorescence with electron microscopy data
Functional redundancy:
Potential compensatory mechanisms in knockout studies
Multiple proteins may have overlapping functions
Subtle phenotypes may be difficult to detect
Time resolution:
Rapid membrane reorganization events may be missed
Challenges in synchronizing cells for temporal studies
Future methodological developments in cryo-electron tomography, super-resolution microscopy, and membrane protein handling techniques may address these limitations .
Emerging approaches that could advance VL3_4134 research include:
CRISPR-based approaches:
Precise genome editing for endogenous tagging
CRISPRi for temporal control of expression
CRISPR screens to identify genetic interactions
Advanced imaging techniques:
Light-sheet microscopy for long-term live imaging
Super-resolution microscopy (PALM/STORM) for nanoscale localization
Correlative light and electron microscopy (CLEM) for structure-function relationships
Proteomics and interactomics:
BioID or APEX proximity labeling to identify interaction partners
Cross-linking mass spectrometry for structural analysis
Quantitative proteomics to identify regulatory modifications
Membrane biophysics:
Reconstitution in giant unilamellar vesicles (GUVs)
Atomic force microscopy of membrane topography
Lipid mass spectrometry to characterize associated lipids
Computational modeling:
Molecular dynamics simulations of membrane interactions
Systems biology approaches to place in regulatory networks
Structural prediction using AlphaFold or similar tools