Recombinant Saccharomyces cerevisiae Vacuolar protein sorting-associated protein 55 (VPS55)

Shipped with Ice Packs
In Stock

Description

Functional Role in Membrane Trafficking

VPS55 operates in late endosome-to-vacuole transport, influencing both biosynthetic and endocytic pathways .

Mechanistic Insights

  • CPY Trafficking: Disruption of VPS55 leads to missorting of carboxypeptidase Y (CPY), causing secretion of its Golgi-modified form (p2CPY) .

  • Endocytic Delay: Uracil permease degradation is delayed in vps55Δ mutants, with transient accumulation in late endosomes .

  • Complex Formation: Forms a stable heterodimer with Vps68p, essential for efficient cargo sorting at multivesicular bodies (MVBs) .

Recombinant Expression and Applications

The recombinant VPS55 protein is expressed in E. coli systems, enabling studies on its interaction networks and trafficking functions .

Experimental Uses

  • Localization Studies: GFP-tagged VPS55 localizes to late endosomes and vacuolar membranes, dependent on SNX-BAR protein Mvp1 and dynamin-like GTPase Vps1 .

  • Mutational Analysis: Alanine scanning identified residues 60–67 in the cytoplasmic domain as critical for endosomal recycling .

  • Functional Complementation: Human OB-RGRP rescues trafficking defects in vps55Δ yeast, confirming functional conservation .

Table 2: Key Functional Studies

Study FocusFindingsSources
CPY Missorting50% secretion of p2CPY in vps55Δ
Endocytic DelayAccumulation of uracil permease in PVC
Complex RoleVps55/68 stabilizes ESCRT-dependent sorting
Human HomologyOB-RGRP complements vps55Δ defects

Evolutionary and Biomedical Relevance

VPS55’s conservation with human OB-RGRP underscores its role in lysosomal trafficking, with implications for obesity-related leptin signaling . Studies using recombinant VPS55 have clarified its interplay with SNX-BAR proteins (e.g., Mvp1) and GTPases (e.g., Vps1), offering a model for dissecting lysosomal disorders .

Future Directions

  • Structural Studies: Cryo-EM analysis of the Vps55/68 complex.

  • Disease Modeling: Assessing OB-RGRP mutations in metabolic syndromes.

  • Drug Screening: Targeting VPS55 interactions to modulate lysosomal function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VPS55; YJR044C; J1637; Vacuolar protein sorting-associated protein 55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
VPS55
Target Protein Sequence
MMEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIFLLAPIPNTIFNAGNK YHTSDFMSDSSNTGQDLAHFLTGMLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSS IVIFKWFFKKDFNEDDSLFG
Uniprot No.

Target Background

Function
VPS55 is involved in protein transport from endosomes to the vacuole.
Gene References Into Functions
  1. Vps55p and Vps68p form a complex that regulates endosomal trafficking, acting with or downstream of ESCRT function. PMID: 18216282
Database Links

KEGG: sce:YJR044C

STRING: 4932.YJR044C

Protein Families
OB-RGRP/VPS55 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Q&A

What is VPS55 and what is its role in Saccharomyces cerevisiae?

VPS55 (encoded by the YJR044c gene) is a small protein of 140 amino acids with four potential transmembrane domains that plays a crucial role in the endosomal transport pathway of Saccharomyces cerevisiae. It functions in late endosome to vacuole trafficking, specifically affecting the transport of soluble vacuolar proteins while not disrupting membrane-bound vacuolar protein trafficking . VPS55 belongs to a conserved family of genes with previously unknown function but has now been identified as a key component of a previously undescribed endosome sorting complex that acts with or downstream of the ESCRT (Endosomal Sorting Complex Required for Transport) machinery .

Studies show that cells with disrupted VPS55 (vps55Δ) present normal vacuolar morphology but exhibit abnormal secretion of the Golgi form of soluble vacuolar carboxypeptidase Y (CPY). While endocytosis remains functional in these cells, degradation of endocytic markers is delayed, with these markers transiently accumulating in late endosomal compartments . This indicates that VPS55 is specifically involved in the regulation of protein sorting in the late endosomal pathway.

What is the structure and subcellular localization of VPS55?

VPS55 is a small protein with four predicted transmembrane domains, suggesting it is an integral membrane protein. Experimental evidence from membrane extraction and subcellular fractionation confirms this structure. When studied using extraction methods, Vps55p remains in the membrane fraction after treatments with lysis buffer alone but can be extracted with detergents like Triton X-100, demonstrating its membrane integration .

Regarding subcellular localization, Vps55p is primarily found in late endosomal compartments. This has been established through subcellular fractionation techniques and colocalization studies with markers of the endosomal system. The localization pattern aligns with its function in regulating trafficking between late endosomes and the vacuole . Interestingly, the human homolog OB-RGRP displays the same distribution pattern when expressed in yeast, suggesting evolutionary conservation of not just sequence but also localization and function .

How does the VPS55/VPS68 complex function in endosomal transport?

VPS55 forms a complex with another protein, VPS68, constituting a previously undescribed endosome sorting complex. This complex was identified through comprehensive phenotypic analysis and computational approaches for global identification of endosomal transport factors . The VPS55/68 complex functions at a step with or downstream of ESCRT machinery to regulate endosomal trafficking.

Specifically, loss of Vps68p disrupts recycling to the trans-Golgi network (TGN) as well as onward trafficking to the vacuole. Interestingly, this disruption occurs without preventing the formation of lumenal vesicles within the multivesicular body (MVB) . This suggests the Vps55/68 complex mediates a novel, conserved step in the endosomal maturation process that affects sorting decisions but not the physical process of MVB formation.

The complex scored highly in computational clustering analysis (p-value = 1.51 × 10^-13; sorting index = 87.6), indicating strong functional association between these components, as shown in Table 1:

Bonferroni p valueSorting indexCluster IDCluster sizeComplex
1.51E-1387.61213VPS55/68 (2)

What phenotypes are observed in VPS55 knockout strains?

Saccharomyces cerevisiae strains with disrupted VPS55 (vps55Δ) exhibit several distinct phenotypes related to protein trafficking:

  • Normal growth: The vps55Δ mutant shows no thermosensitivity and grows normally at various temperatures (15°C, 24°C, 30°C, and 37°C) .

  • Normal vacuolar morphology: Despite the trafficking defects, the vacuolar structure appears normal in these cells .

  • Abnormal secretion of CPY: The most prominent phenotype is the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y into the extracellular medium, indicating a sorting defect at the Golgi-to-endosome transport step .

  • Normal trafficking of membrane proteins: Transport of membrane-bound vacuolar alkaline phosphatase remains unaffected, suggesting that VPS55 selectively impacts soluble protein trafficking but not membrane protein trafficking .

  • Delayed degradation of endocytic markers: While initial endocytosis of markers like uracil permease is normal, their degradation is delayed, and they transiently accumulate in late endosomal compartments, suggesting a defect in the final stages of the endocytic pathway .

These phenotypes collectively indicate that VPS55 is specifically involved in regulating protein transport from late endosomes to the vacuole and plays a selective role in the trafficking of different cargo types.

How can I generate a recombinant VPS55 strain with epitope tags?

Generation of epitope-tagged VPS55 strains involves PCR-based strategies targeting the endogenous gene locus. Based on the methodologies described in the literature, the following approach is recommended:

  • PCR amplification of tagging cassettes:

    • For C-terminal tagging, amplify fragments containing the desired tag (HA, Myc, or GFP) and a selection marker (e.g., kanMX6) using primers with homology to the VPS55 locus.

    • Use oligonucleotides F2-VPS55 and R1-VPS55 for the PCR reaction.

    • Use plasmids such as pFA6a-GFPS65T-kanMX6, pFA6a-13Myc-kanMX6, or pFA6a-3HA-kanMX6 as templates .

  • Transformation and selection:

    • Transform the PCR products into the desired yeast strain using standard lithium acetate transformation protocols.

    • Select transformants on appropriate selective media (e.g., G418 for kanMX6).

    • Confirm correct integration by PCR and/or Western blotting.

  • Alternative expression approaches:

    • For controlled expression, VPS55 can be cloned into vectors with inducible promoters.

    • For example, PCR-amplify VPS55 with BamHI/NotI restriction sites using VPS55-F and VPS55-R primers.

    • Clone the fragment into the BamHI and NotI sites of pYEF2 to place VPS55 under the control of the GAL10 promoter and in frame with an HA epitope .

This approach allows for the generation of strains expressing tagged Vps55p from its endogenous locus or from an inducible promoter, facilitating various experimental applications including localization studies, protein-protein interaction analyses, and functional assays.

What approaches are recommended for studying VPS55 membrane topology?

To study the membrane topology of VPS55, which has four predicted transmembrane domains, several complementary approaches are recommended:

  • Membrane extraction assays:

    • Prepare spheroplasts from cells expressing tagged Vps55p (e.g., Vps55-HA).

    • Homogenize the cells and subject the homogenate to different extraction conditions:
      a) Lysis buffer alone: Tests whether the protein is membrane-associated.
      b) 1% Triton X-100 in lysis buffer: Extracts integral membrane proteins.
      c) 0.1 M sodium carbonate (pH 11.5): Extracts peripheral membrane proteins but not integral proteins.

    • Separate membrane and soluble fractions by ultracentrifugation at 100,000 × g.

    • Analyze protein distribution by SDS-PAGE and immunoblotting .

  • Protease protection assays:

    • Isolate microsomes containing Vps55p.

    • Treat samples with proteases (e.g., proteinase K) in the presence or absence of detergent.

    • Analyze the protected fragments by immunoblotting to determine which portions of the protein are accessible to proteases.

  • Fluorescence-based approaches:

    • Generate Vps55p constructs with GFP fusions at different positions.

    • Use pH-sensitive GFP variants to determine whether specific domains face the cytosol or the lumen.

    • Analyze by fluorescence microscopy and flow cytometry.

  • Computational prediction and validation:

    • Use topology prediction algorithms to generate models of Vps55p membrane orientation.

    • Validate these predictions experimentally using the above approaches.

These methods provide complementary information about the membrane topology of Vps55p, helping to establish which domains are cytosolic, which are transmembrane, and which face the lumen of organelles.

How can protein-protein interactions of VPS55 be studied?

Investigating protein-protein interactions of VPS55 is crucial for understanding its function in endosomal transport. Several approaches can be employed:

  • Co-immunoprecipitation (Co-IP):

    • Generate strains expressing epitope-tagged Vps55p (e.g., Vps55-HA or Vps55-Myc).

    • Prepare cell lysates under conditions that preserve protein complexes.

    • Immunoprecipitate Vps55p using antibodies against the epitope tag.

    • Analyze co-precipitated proteins by SDS-PAGE followed by immunoblotting or mass spectrometry.

    • This approach was instrumental in identifying the interaction between Vps55p and Vps68p .

  • Yeast two-hybrid assays:

    • Clone VPS55 into bait vectors and screen against prey libraries or specific candidate interactors.

    • Validate positive interactions by directed two-hybrid tests and alternative methods.

    • Consider using membrane yeast two-hybrid systems that are optimized for membrane proteins.

  • Proximity-based labeling:

    • Fuse Vps55p to enzymes like BioID or APEX2 that can biotinylate nearby proteins.

    • Purify biotinylated proteins and identify them by mass spectrometry.

    • This approach can capture transient or weak interactions in the native cellular environment.

  • Genetic interaction screens:

    • Perform systematic analysis of double mutants involving vps55Δ and mutations in other genes.

    • Use techniques like synthetic genetic array (SGA) analysis.

    • Identify genetic interactions that suggest functional relationships.

    • This approach can complement physical interaction studies and provide functional context .

  • Fluorescence-based techniques:

    • Fluorescence resonance energy transfer (FRET) between Vps55p and candidate interactors.

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in live cells.

    • Fluorescence cross-correlation spectroscopy (FCCS) to detect co-diffusion of fluorescently labeled proteins.

These methodologies provide complementary information about Vps55p interactions, helping to build a comprehensive picture of its role in protein complexes and cellular pathways.

What methods are effective for assessing VPS55 function in endosomal trafficking?

To assess the function of VPS55 in endosomal trafficking, several robust methodologies can be employed:

  • CPY secretion assay:

    • Culture cells in media and collect both cellular and extracellular fractions.

    • Analyze the presence of CPY in the extracellular fraction by immunoblotting.

    • Quantify the ratio of secreted to intracellular CPY to measure sorting efficiency.

    • This assay directly assesses the classical phenotype of vps55Δ strains .

  • Pulse-chase analysis of vacuolar protein trafficking:

    • Pulse-label cells with radioactive amino acids (e.g., 35S-methionine).

    • Chase with non-radioactive media and collect samples at various time points.

    • Immunoprecipitate specific vacuolar proteins (e.g., CPY).

    • Analyze by SDS-PAGE and fluorography to track maturation and transport.

    • This approach allows for kinetic analysis of protein trafficking .

  • Fluorescence microscopy of GFP-tagged cargo proteins:

    • Express GFP-tagged versions of cargo proteins (e.g., GFP-CPY).

    • Visualize their localization in wild-type versus vps55Δ cells.

    • Use time-lapse imaging to track dynamic trafficking events.

    • Co-localize with organelle markers to identify specific compartments where cargo accumulates.

  • Endocytic trafficking assays:

    • Monitor the internalization and degradation of endocytic markers (e.g., uracil permease).

    • Use fluorescent dyes like FM4-64 to track endocytic membrane trafficking.

    • Quantify the kinetics of marker degradation to assess late endosome-to-vacuole transport .

  • Subcellular fractionation:

    • Separate cellular organelles by differential centrifugation.

    • Analyze the distribution of cargo proteins across fractions.

    • Compare patterns between wild-type and vps55Δ cells to identify specific steps affected.

    • This approach can reveal accumulation of cargo in specific compartments .

  • Electron microscopy:

    • Examine ultrastructural features of endosomes and vacuoles.

    • Use immunogold labeling to localize specific proteins.

    • Assess morphological changes in the endosomal system in vps55Δ cells.

These methods provide comprehensive assessment of Vps55p's role in different aspects of endosomal trafficking and can be combined to obtain a detailed understanding of its function.

How is VPS55 involved in the broader context of cellular homeostasis?

VPS55 plays a critical role in cellular homeostasis through its function in the endosomal pathway, which impacts multiple cellular processes:

  • Protein quality control: The endosomal-vacuolar system is essential for degrading misfolded or damaged proteins. VPS55, through its role in late endosome-to-vacuole trafficking, contributes to this quality control mechanism. Disruption of VPS55 can lead to accumulation of proteins that should be targeted for degradation, potentially leading to cellular stress .

  • Nutrient recycling: The vacuole/lysosome serves as a site for the breakdown and recycling of cellular components. By ensuring proper trafficking to this compartment, VPS55 contributes to the cell's ability to recycle amino acids and other building blocks, particularly under nutrient-limited conditions.

  • Membrane homeostasis: The endosomal system is central to membrane turnover and remodeling. VPS55's function in sorting membrane proteins and lipids affects membrane composition and organization throughout the cell .

  • Signaling regulation: Many signaling receptors are downregulated through the endosomal pathway. The VPS55/68 complex may influence cell signaling by affecting the kinetics of receptor degradation or recycling to the plasma membrane.

  • Response to stress: Proper function of the endosomal-vacuolar system is crucial for cellular adaptation to various stresses. VPS55-mediated trafficking contributes to this adaptive response by ensuring appropriate sorting and degradation of proteins under stress conditions.

These diverse roles highlight the importance of VPS55 in maintaining cellular homeostasis and explain why its function has been conserved throughout evolution from yeast to humans .

What is the relationship between yeast VPS55 and human OB-RGRP?

The relationship between yeast VPS55 and human OB-RGRP (Obesity Receptor Gene-Related Protein) represents a fascinating case of functional conservation across evolutionarily distant species:

This evolutionary conservation highlights the fundamental importance of endosomal trafficking mechanisms and positions S. cerevisiae as a valuable model organism for studying aspects of human cell biology related to endosomal transport and potentially metabolic regulation.

How does the VPS55/VPS68 complex interact with other endosomal sorting machinery?

The VPS55/VPS68 complex interacts with other endosomal sorting machinery in a complex network that orchestrates proper protein trafficking:

  • Relationship with ESCRT machinery: The VPS55/VPS68 complex has been shown to act with or downstream of the ESCRT (Endosomal Sorting Complex Required for Transport) function. While ESCRT complexes are primarily involved in the formation of intraluminal vesicles (ILVs) in multivesicular bodies (MVBs), the VPS55/VPS68 complex appears to function in a different capacity that affects endosomal maturation without preventing ILV formation .

  • Distinct from retromer function: Clustering analysis from large-scale phenotypic studies positions the VPS55/VPS68 complex as functionally distinct from the retromer complex, which is involved in recycling proteins from endosomes to the trans-Golgi network (TGN). This suggests these complexes act in parallel pathways rather than sequentially , as shown in Table 2:

Bonferroni p valueSorting indexCluster IDComplex
1.51E-1387.6121VPS55/68 (2)
9.76E-0997.0211Retromer (4)
2.70E-0799.3200Retromer (2)
1.52E-0559.0233ESCRT (13)
  • Impact on multiple trafficking routes: Loss of Vps68p (and by extension, disruption of the VPS55/VPS68 complex) affects both recycling to the TGN and forward trafficking to the vacuole. This suggests the complex may function at a decision point where protein sorting to different destinations occurs .

  • Potential role in endosomal maturation: The observation that the VPS55/VPS68 complex affects endosomal trafficking without disrupting ILV formation suggests it may play a role in the maturation of endosomes, possibly by regulating fusion events or the recruitment of other trafficking factors .

  • Conservation across species: The conservation of the VPS55/VPS68 complex from yeast to higher eukaryotes suggests it represents a fundamental mechanism in endosomal trafficking that works alongside other well-characterized complexes like ESCRT and retromer .

Understanding these interactions is crucial for developing a comprehensive model of endosomal sorting and identifying potential therapeutic targets for diseases related to trafficking defects.

Can S. cerevisiae VPS55 serve as a model for studying human endosomal trafficking disorders?

Saccharomyces cerevisiae VPS55 has significant potential as a model for studying human endosomal trafficking disorders for several reasons:

  • Functional conservation: The human homolog of VPS55, OB-RGRP, can functionally complement the vps55Δ yeast strain, demonstrating remarkable conservation of function across vast evolutionary distances. This suggests mechanistic insights gained from studying yeast VPS55 are likely relevant to human biology .

  • S. cerevisiae as a model organism: Comprehensive analysis of S. cerevisiae as a model organism has shown that it shares significant biological pathway conservation with humans, particularly for fundamental cellular processes like protein trafficking. This makes yeast an excellent system for studying conserved aspects of endosomal transport .

  • Experimental advantages: The ease of genetic manipulation, rapid growth, and extensive genetic tools available for S. cerevisiae make it possible to conduct experiments that would be challenging or impossible in human cells. These include high-throughput screens, detailed structure-function analyses, and rapid testing of human disease-associated variants .

  • Relevance to human diseases: Endosomal trafficking defects are implicated in numerous human disorders, including neurodegenerative diseases (Alzheimer's, Parkinson's), lysosomal storage disorders, and certain cancers. The VPS55/68 complex represents a previously understudied component of this system that could provide new insights into disease mechanisms .

  • Pathway-specific modeling: Comparative analysis between S. cerevisiae and other organisms has identified the specific pathways and processes for which yeast is an appropriate model. For endosomal trafficking, yeast shows particularly high conservation with humans, making it an excellent model for this specific cellular process .

  • Translation to higher models: Discoveries made in yeast can guide more focused studies in complex model organisms and human cells, accelerating the research process and potentially leading to new therapeutic approaches for endosomal trafficking disorders.

The combination of these factors makes S. cerevisiae VPS55 a valuable model for understanding fundamental aspects of endosomal trafficking relevant to human health and disease.

What are the challenges in distinguishing direct versus indirect effects when studying VPS55 function?

Distinguishing direct from indirect effects in VPS55 functional studies presents several challenges that researchers must carefully address:

  • Network complexity: The endosomal trafficking system involves numerous interconnected proteins and complexes. Disruption of VPS55 may cause cascading effects throughout this network, making it difficult to determine which phenotypes are directly caused by VPS55 absence and which are secondary consequences .

  • Cargo-specific effects: VPS55 deletion affects some cargo proteins (soluble vacuolar proteins like CPY) but not others (membrane proteins like alkaline phosphatase) . This selective impact complicates interpretation – are these truly direct versus indirect effects, or does VPS55 have cargo-specific functions?

  • Temporal considerations: The endosomal system is highly dynamic. Effects observed at different time points after VPS55 disruption may represent either direct impacts or compensatory mechanisms that develop over time.

  • Methodological limitations:

    • Steady-state assays may not capture the dynamic nature of trafficking events.

    • Overexpression systems can create artificial phenotypes that don't reflect physiological functions.

    • Global approaches like proteomics may detect numerous changes without distinguishing cause from effect.

  • Approaches to address these challenges:

    • Acute inactivation: Use rapid degradation systems or temperature-sensitive alleles to observe immediate effects before compensatory mechanisms develop.

    • Structure-function studies: Create point mutations affecting specific domains or interactions rather than complete gene deletion.

    • In vitro reconstitution: Reconstitute specific steps of the trafficking pathway with purified components to test direct functions.

    • Suppressor screens: Identify mutations that restore function in vps55Δ backgrounds, potentially revealing direct pathways.

    • Systematic pairwise knockouts: Compare phenotypes of single and double mutants to map genetic relationships and pathway organization .

By employing these approaches and carefully designing experiments with appropriate controls, researchers can better distinguish the direct functions of VPS55 from secondary effects resulting from disruption of the endosomal system.

How can researchers effectively study VPS55 transmembrane topology and its functional implications?

Studying VPS55 transmembrane topology and its functional implications requires integrated experimental approaches:

  • Combining computational and experimental methods:

    • Begin with computational prediction of transmembrane domains using multiple algorithms.

    • Validate predictions experimentally using techniques like cysteine accessibility scanning, epitope insertion, and protease protection assays.

    • Generate a consensus topology model that integrates all data sources.

  • Structure-guided mutagenesis approach:

    • Based on the established topology model, design targeted mutations in specific transmembrane domains or loops.

    • Create a library of point mutations, deletions, or domain swaps.

    • Assess the impact of these mutations on VPS55 localization, protein-protein interactions, and function.

    • This approach can identify which regions are critical for specific aspects of VPS55 function.

  • Crosslinking strategies to capture interaction interfaces:

    • Introduce photo-activatable or chemical crosslinkers at specific positions.

    • Identify crosslinked partners by mass spectrometry.

    • Map interaction interfaces between VPS55 and other proteins, particularly VPS68.

    • This approach can reveal how the transmembrane domains contribute to complex formation and function.

  • Dynamic conformational changes:

    • Investigate whether VPS55 undergoes conformational changes during the trafficking process.

    • Use techniques like FRET with fluorophores placed at strategic positions based on the topology model.

    • Correlate conformational states with specific trafficking steps or cargo interactions.

  • Comparative approach leveraging evolutionary conservation:

    • Compare the predicted topology of VPS55 with its homologs across species, including human OB-RGRP.

    • Identify conserved residues within transmembrane domains that may be functionally important.

    • Test functional complementation with chimeric proteins that swap domains between species.

    • This approach can distinguish structurally important features from functionally critical regions.

  • Integration with global trafficking studies:

    • Correlate topology findings with global endosomal sorting phenotypes.

    • Determine how specific structural features contribute to the protein's role in the VPS55/68 complex and broader endosomal sorting network.

These integrated approaches can provide a comprehensive understanding of how VPS55's membrane topology relates to its function in endosomal trafficking, potentially revealing new therapeutic targets for trafficking-related diseases.

What are the best approaches for studying potential post-translational modifications of VPS55?

Investigating post-translational modifications (PTMs) of VPS55 requires a comprehensive strategy that encompasses discovery, validation, and functional characterization:

  • Global discovery approaches:

    • Mass spectrometry-based proteomics: Purify epitope-tagged VPS55 and analyze by LC-MS/MS to identify PTMs comprehensively.

    • Use enrichment strategies specific for different modification types (phosphorylation, ubiquitination, etc.).

    • Compare PTM profiles under different conditions (nutrient availability, stress, etc.) to identify regulated modifications.

    • Employ both data-dependent and targeted mass spectrometry approaches for maximum coverage.

  • Site-specific validation:

    • Generate antibodies specific to modified forms of VPS55.

    • Create point mutations at putative modification sites to prevent specific PTMs.

    • Use site-specific chemical biology approaches (e.g., genetic code expansion) to introduce PTM mimics at precise positions.

    • Compare wild-type VPS55 with modification-deficient mutants in functional assays.

  • Dynamic regulation analysis:

    • Conduct time-course studies following cellular perturbations to track changes in VPS55 modifications.

    • Identify the enzymes responsible for adding and removing PTMs through candidate approaches or genetic screens.

    • Test whether modifications are interdependent or mutually exclusive.

    • Monitor localization changes of modified versus unmodified VPS55 pools.

  • Functional characterization:

    • Assess the impact of modification-deficient mutants on endosomal trafficking using the assays described in section 2.4.

    • Test whether modifications affect VPS55's interaction with VPS68 or other binding partners.

    • Determine if modifications are cargo-specific or respond to particular trafficking conditions.

    • Investigate potential cross-talk between VPS55 modifications and the activity of other endosomal sorting complexes.

  • Evolutionary perspective:

    • Compare modification sites across species to identify conserved regulatory mechanisms.

    • Test whether human OB-RGRP undergoes similar modifications when expressed in yeast.

    • Examine whether the same enzymes target both yeast VPS55 and human OB-RGRP.

This multifaceted approach can reveal how post-translational modifications contribute to VPS55 function, potentially uncovering new regulatory mechanisms in endosomal trafficking and providing insights into how these processes are controlled in response to cellular needs.

How can genetic interaction screens be optimized to identify novel functional relationships of VPS55?

Optimizing genetic interaction screens for VPS55 requires strategic experimental design to uncover meaningful functional relationships while minimizing false positives and negatives:

  • Selection of screening approach:

    • Synthetic Genetic Array (SGA): Cross vps55Δ with genome-wide deletion collections to identify synthetic lethal/sick interactions.

    • Dosage suppressor screens: Overexpress genomic libraries in vps55Δ to identify suppressors.

    • CRISPR-based screens: Use CRISPR interference or activation libraries in combination with VPS55 manipulation.

    • Chemical-genetic screens: Test sensitivity of vps55Δ to compound libraries to identify pathways with functional connections.

  • Phenotypic readout optimization:

    • Beyond growth: While growth defects are standard readouts, they may miss subtle interactions.

    • Cargo-specific assays: Monitor CPY secretion, which is directly affected by VPS55 function .

    • Fluorescent reporters: Develop high-throughput microscopy assays to detect changes in endosomal morphology or protein localization.

    • Stress conditions: Test interactions under various stresses to reveal condition-specific relationships.

  • Network analysis strategies:

    • Hierarchical clustering: Group genes with similar genetic interaction profiles to identify functional modules .

    • Apply statistical measures like those shown in Table 1, including Bonferroni-corrected p-values and sorting indices to identify significant interactions .

    • Compare VPS55 interaction profiles with those of known endosomal sorting factors to position it within the pathway.

    • Look for interactions that connect VPS55 to unexpected cellular processes, potentially revealing novel functions.

  • Validation and follow-up:

    • Confirm key interactions using multiple independent assays.

    • Test interactions in different genetic backgrounds to rule out strain-specific effects.

    • Perform reciprocal experiments (e.g., overexpression of VPS55 in deletion strains of interaction partners).

    • Combine genetic interactions with physical interaction data to build integrated functional networks.

  • Cross-species comparison:

    • Test whether genetic interactions identified in yeast are conserved in higher organisms.

    • Use comparative genomics to prioritize interactions involving evolutionarily conserved genes.

    • Explore whether human OB-RGRP has similar genetic interactions when expressed in yeast.

By implementing these optimized screening strategies, researchers can build a comprehensive picture of VPS55's functional relationships within the cell, potentially discovering novel connections to other cellular processes and identifying new components of endosomal trafficking pathways.

What are common pitfalls when interpreting VPS55 localization studies and how can they be addressed?

Interpreting VPS55 localization studies presents several challenges that researchers should be aware of and address:

  • Overexpression artifacts:

    • Pitfall: Overexpressing tagged VPS55 can lead to mislocalization, saturation of trafficking machinery, or formation of aggregates.

    • Solution: Use endogenous tagging approaches that maintain native expression levels. Compare results from different expression systems and validate with antibodies against the endogenous protein when possible .

  • Tag interference:

    • Pitfall: Tags (GFP, HA, etc.) may interfere with VPS55's membrane topology, protein interactions, or function.

    • Solution: Test multiple tag positions (N-terminal, C-terminal, internal) and different types of tags. Always validate that tagged constructs complement vps55Δ phenotypes .

  • Fixation artifacts:

    • Pitfall: Chemical fixation can alter membrane structures and protein localization patterns.

    • Solution: Compare fixed and live-cell imaging results. Use rapid fixation protocols optimized for membrane proteins. Validate with orthogonal approaches like subcellular fractionation.

  • Dynamic localization misinterpretation:

    • Pitfall: VPS55 may traffic between compartments, and single-timepoint imaging can miss these dynamics.

    • Solution: Perform time-lapse imaging and pulse-chase experiments with photoactivatable fluorescent proteins. Track VPS55 movement relative to established organelle markers.

  • Marker specificity issues:

    • Pitfall: Endosomal compartments exist on a maturation continuum, making precise assignment to specific compartments challenging.

    • Solution: Use multiple independent markers for each compartment. Combine with functional assays that test specific trafficking steps. Consider super-resolution microscopy to resolve closely related compartments.

  • Cell cycle and condition variations:

    • Pitfall: VPS55 localization may vary with cell cycle or growth conditions.

    • Solution: Synchronize cells or use markers to identify cell cycle stages during imaging. Test multiple growth conditions and stress treatments to identify condition-dependent localization changes.

  • Strain background effects:

    • Pitfall: Different yeast strain backgrounds may show subtle variations in endomembrane organization.

    • Solution: Verify key findings in multiple strain backgrounds. Include appropriate controls from the same strain background in all experiments.

By addressing these pitfalls with rigorous experimental design and appropriate controls, researchers can obtain reliable and physiologically relevant information about VPS55 localization and its relationship to function in endosomal trafficking.

How can conflicting results in VPS55 functional studies be reconciled?

Reconciling conflicting results in VPS55 functional studies requires a systematic approach that considers multiple factors that could contribute to discrepancies:

  • Methodological differences:

    • Different assays may measure distinct aspects of VPS55 function, leading to apparently contradictory results.

    • Solution: Directly compare methodologies, standardize protocols, and use multiple independent assays to assess each function. Consider whether assays measure direct or indirect effects .

  • Strain background variations:

    • Genetic differences between laboratory strains can influence VPS55-related phenotypes.

    • Solution: Repeat key experiments in multiple strain backgrounds. Create isogenic strains that differ only in VPS55 status. Document complete strain genotypes in publications to facilitate reproducibility.

  • Environmental conditions:

    • Growth conditions, media composition, and stress factors can modulate VPS55 function.

    • Solution: Systematically test different conditions to identify context-dependent effects. Standardize growth protocols and report detailed media compositions.

  • Genetic compensation mechanisms:

    • Chronic loss of VPS55 may trigger compensatory pathways that mask primary defects.

    • Solution: Use acute inactivation approaches (e.g., degron tags, temperature-sensitive alleles) to observe immediate effects before compensation occurs. Compare acute versus chronic VPS55 loss phenotypes.

  • Cargo-specific effects:

    • VPS55 affects different cargo proteins differently (e.g., CPY versus alkaline phosphatase) .

    • Solution: Assess multiple cargo proteins in parallel. Develop models that account for cargo-specific effects rather than expecting uniform impact on all trafficking.

  • Technical considerations in protein detection:

    • Different antibodies, tags, or detection methods can yield varying results.

    • Solution: Validate reagents rigorously. Use multiple detection methods and consider absolute quantification approaches like selected reaction monitoring mass spectrometry.

  • Integrated data analysis approach:

    • Develop computational models that integrate diverse datasets.

    • Weight evidence based on methodological rigor and reproducibility.

    • Identify conditions under which conflicting results can be reconciled.

    • Consider network-level analyses that place VPS55 in the broader context of endosomal trafficking .

  • Collaborative resolution:

    • Establish direct collaborations between groups reporting conflicting results.

    • Exchange reagents, protocols, and staff to determine the source of discrepancies.

    • Perform joint experiments with standardized protocols.

This systematic approach can help resolve apparent contradictions in the literature and develop a more nuanced understanding of VPS55 function that accounts for context-specific effects and methodological considerations.

What controls are essential when performing genetic complementation studies with VPS55 homologs?

When conducting genetic complementation studies with VPS55 homologs, such as testing whether human OB-RGRP can rescue vps55Δ phenotypes in yeast, several essential controls must be included:

  • Expression-level controls:

    • Verify that the homolog is expressed at levels comparable to endogenous Vps55p.

    • Use quantitative western blotting or mass spectrometry to compare expression levels.

    • Test multiple expression levels if using inducible promoters to determine whether complementation is dose-dependent.

    • Include both over-expression and endogenous-level expression constructs to distinguish physiological function from dosage effects .

  • Localization controls:

    • Confirm that the homolog localizes similarly to native Vps55p.

    • Use fluorescent tags or immunofluorescence to compare subcellular distribution.

    • Co-localize with established markers of relevant compartments.

    • Ensure that any tags used do not interfere with localization or function .

  • Genetic background controls:

    • Use a clean vps55Δ strain without additional mutations that might influence the phenotype.

    • Include wild-type, empty vector, and vps55Δ no-plasmid controls in all experiments.

    • Consider potential interactions with strain-specific factors by testing in multiple strain backgrounds.

  • Functional readout controls:

    • Assess multiple vps55Δ phenotypes (CPY secretion, endocytic marker degradation, etc.) to determine whether complementation is complete or partial.

    • Include quantitative assays rather than simply qualitative assessments.

    • Test complementation under various conditions (different temperatures, stresses, etc.) .

  • Specificity controls:

    • Test complementation with homologs from multiple species to establish evolutionary conservation patterns.

    • Include non-homologous membrane proteins as negative controls.

    • Create chimeric proteins or point mutations to map the regions necessary for functional complementation.

    • Test whether the homolog can complement other vps mutants to assess specificity .

  • Time-dependence controls:

    • Monitor complementation over time to distinguish between immediate rescue and adaptive responses.

    • Use inducible systems to assess acute versus chronic expression effects.

  • Complex formation controls:

    • Determine whether the homolog interacts with Vps68p or other yeast partners of Vps55p.

    • Assess whether complex formation correlates with functional complementation.

    • Test whether co-expression of partnering proteins from the same species enhances complementation .

These controls ensure that complementation studies provide meaningful insights into the functional conservation of VPS55 homologs and help distinguish true functional rescue from artifacts or partial effects.

How can researchers effectively compare VPS55 function across different yeast species and other model organisms?

Comparing VPS55 function across different species requires a comprehensive approach that accounts for evolutionary divergence while focusing on conserved mechanisms:

  • Standardized experimental framework:

    • Develop a core set of assays that can be applied consistently across species.

    • Establish equivalent genetic manipulation strategies (e.g., CRISPR-based methods) that work in multiple organisms.

    • Create comparable expression systems that account for codon usage and transcriptional regulation differences.

    • Design species-neutral antibodies or tags that recognize conserved epitopes.

  • Phylogenetic approach:

    • Perform comprehensive sequence analysis to establish evolutionary relationships between VPS55 homologs.

    • Identify conserved residues and domains that may be functionally critical.

    • Use ancestral sequence reconstruction to understand evolutionary trajectories.

    • Select species strategically to cover key evolutionary transitions.

  • Complementation strategy:

    • Test cross-species complementation bidirectionally (e.g., can human OB-RGRP complement yeast vps55Δ and can yeast VPS55 rescue mammalian cell lines with OB-RGRP knockdown?).

    • Create chimeric proteins swapping domains between species to map functional regions.

    • Express homologs with their native binding partners to maintain complex integrity .

  • Comparative phenomics:

    • Develop equivalent phenotypic assays for each species (e.g., vacuolar/lysosomal protein sorting).

    • Use high-content imaging to quantitatively compare subcellular morphology and protein localization.

    • Apply systems biology approaches to map genetic interaction networks across species.

    • Develop computational methods to normalize and compare phenotypes between different cellular contexts .

  • Species-specific considerations:

    • For S. cerevisiae vs. other yeast species: Compare haploid vs. diploid states, different carbon source utilization, and stress responses.

    • For yeast vs. mammalian systems: Account for tissue-specific expression and regulation in multicellular organisms.

    • For other model organisms: Develop appropriate tissue-specific or developmental stage-specific analyses.

  • Leveraging unique advantages of each system:

    • Use S. cerevisiae for high-throughput genetic screens and detailed biochemistry .

    • Use mammalian cell culture for tissue-specific factors and complex regulation.

    • Use multicellular organisms to assess organismal phenotypes and tissue-specific functions.

    • Integrate data across systems to build comprehensive functional models.

  • Computational integration:

    • Develop algorithms to integrate heterogeneous data from different species.

    • Create predictive models of functional conservation and divergence.

    • Use machine learning approaches to identify patterns not apparent in single-species studies .

This multi-faceted approach can reveal both the core conserved functions of VPS55 and species-specific adaptations, providing insight into the evolution of endosomal trafficking systems and their role in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.