Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 1 (VTC1)

Shipped with Ice Packs
In Stock

Description

General Information

The Saccharomyces Genome Database (SGD) provides biological information regarding Saccharomyces cerevisiae . VTC1 is a vacuolar transporter gene that receives multiple independent mutations in different lines .

Function and Structure

VTC1 is a protein that functions in multiple membrane traffic pathways . It is required for the transport of alkaline phosphatase from the Golgi to the vacuole and in targeting aminopeptidase I from the cytosol to the vacuole . VTC1 interacts genetically with VAM3, the vacuolar t-SNARE required for the transport of both alkaline phosphatase and aminopeptidase I to the vacuole .

VTC1 interacts with t-SNAREs Pep12p in traffic from the TGN to the prevacuolar compartment and with Sed5p in retrograde traffic to the cis-Golgi . Vti1p mediates multiple fusion steps and requires additional proteins to ensure specificity in membrane traffic .

Role in Copper Tolerance

VTC1 plays a significant role in the adaptation of Saccharomyces cerevisiae to copper-rich environments . Copper is essential for various enzymatic processes but is toxic in high concentrations . Adaptive mutations in VTC1 have been identified in yeast strains exposed to inhibitory levels of copper sulfate, indicating its involvement in copper tolerance .

RNA Binding Properties

VTC1 is among the proteins in Saccharomyces cerevisiae that bind RNA, participating in the post-transcriptional regulation of RNAs . Though VTC1 lacks domains known to bind RNA, it co-purifies with sets of mRNAs, suggesting genuine RNA-protein interactions .

Interactions with Other Proteins

VTC1 interacts functionally with the vacuolar t-SNARE Vam3p in different biosynthetic pathways to the vacuole . VTC1 is required for the transport of alkaline phosphatase (ALP) from the Golgi apparatus to the vacuole and traffic of aminopeptidase I (API) from the cytosol to the vacuole through the CVT pathway . Overproduction of Vam3p can partially suppress defects in vti1-ts mutants, indicating that VTC1 acts in the same step as Vam3p and is part of a SNARE complex required for fusion with the vacuole .

VTC1 and Vacuolar Traffic

VTC1 interacts functionally with the vacuolar t-SNARE Vam3p in at least two different biosynthetic pathways to the vacuole :

  • ALP Transport: VTC1 is required for the transport of ALP from the Golgi apparatus to the vacuole .

  • API Transport: VTC1 is involved in traffic of API from the cytosol to the vacuole through the CVT pathway .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VTC1; NRF1; PHM4; YER072W; Vacuolar transporter chaperone 1; Negative regulator of CDC42 protein 1; Phosphate metabolism protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
Full Length
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
VTC1
Target Protein Sequence
MSSAPLLQRTPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLGGLGVGLLNFGDKIGRVSAGLFTFVAMGTMIYALVTYHWRAAAIRRRGSGPYDDRLGPTLLCFFLLVAVIINFILRLKYNDANTKL
Uniprot No.

Target Background

Function
Vacuolar transporter chaperone 1 (VTC1) is a component of the vacuolar transporter chaperone (VTC) complex, playing a crucial role in vacuolar membrane fusion. It is essential for SEC18/NSF activity in SNARE priming, membrane binding of LMA1, and V(0) trans-complex formation.
Database Links

KEGG: sce:YER072W

STRING: 4932.YER072W

Protein Families
VTC1 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is VTC1 and what is its role in yeast cells?

VTC1 is a small membrane protein that forms an essential component of the vacuolar transporter chaperone (VTC) complex in Saccharomyces cerevisiae. It contains three transmembrane helices and is almost completely embedded in the membrane . The VTC complex exists in two isoforms (VTC1/2/4 or VTC1/3/4) with a stoichiometry of 3:1:1, meaning there are three VTC1 molecules for each VTC3/4 or VTC2/4 pair . VTC1 serves as a structural component of the complex, contributing its transmembrane helices to form part of the polyphosphate-selective channel that enables the transport of newly synthesized polyphosphate into the vacuolar lumen . The VTC complex plays crucial roles in microautophagy and polyphosphate metabolism, helping maintain phosphate homeostasis in yeast cells .

How does VTC1 contribute to the structure and function of the VTC complex?

Recent cryo-electron microscopy studies have revealed that the VTC complex has a heteropentameric architecture consisting of one VTC4, one VTC3 (or VTC2), and three VTC1 subunits . The transmembrane regions of all these subunits together form a polyphosphate-selective channel comprised of 15 transmembrane helices . VTC1, with its three transmembrane helices per molecule, contributes nine of these helices to the channel structure .

While VTC1 itself does not possess catalytic activity for polyphosphate synthesis (this function resides in the VTC4 subunit), it is essential for the complex's proper assembly and function . The arrangement of the transmembrane helices creates a pathway for polyphosphate translocation across the vacuolar membrane. The catalytic VTC4 central domain is positioned above this channel, creating an electropositive pathway for nascent polyphosphate that couples synthesis to translocation . In the resting state, a latch-like horizontal helix of VTC4 limits the entrance to the channel .

What experimental systems are used to study VTC1?

Several experimental approaches have been employed to study VTC1 function:

  • Genetic approaches: Deletion of VTC1 to study its role in microautophagy and polyphosphate metabolism .

  • Protein tagging: N-terminal tagging of VTC1 with GFP for localization studies using PCR-based methods with plasmids like pYM-N9, expressing the tagged proteins at their genomic locus under control of an integrated ADH promoter .

  • Protein expression systems: Expression of His-tagged VTC1 in E. coli BL21 in LB medium with induction using 0.5 mM IPTG at 25°C for in vitro studies .

  • Affinity purification: Insertion of affinity tags (e.g., His-TEV-Protein A) at the C-terminus of VTC proteins to purify endogenous VTC complexes for structural and functional studies .

  • In vitro reconstitution: Development of reconstituted systems to study microautophagic uptake and polyphosphate synthesis .

How do inositol pyrophosphates regulate the VTC complex activity?

Inositol pyrophosphates (PP-InsPs) are key regulators of the VTC complex's activity, although they do not directly interact with VTC1 . Instead, PP-InsPs primarily interact with the SPX domains found in VTC2 and VTC3 subunits to control VTC complex activity . Recent studies have provided atomic-level insights into how these interactions occur .

VTC1 itself does not contain an SPX domain, but as an integral part of the VTC complex, its function is indirectly influenced by these regulatory interactions . When inositol pyrophosphates bind to the SPX domains of VTC2 or VTC3, they trigger conformational changes in the complex that activate polyphosphate synthesis by the VTC4 subunit and potentially alter the configuration of the transmembrane channel to which VTC1 contributes .

Specifically, binding of inositol pyrophosphates to VTC2 has been shown to abrogate homotypic SPX-SPX interactions between VTC2 and VTC4, thereby activating the VTC complex . Additionally, the noncatalytic VTC3 regulates the VTC complex through a phosphorylatable loop . Since VTC1 is an obligate component of the complex and contributes to the formation of the polyphosphate channel, these regulatory mechanisms ultimately affect VTC1's function in polyphosphate translocation .

What role does VTC1 play in microautophagy?

VTC1, as part of the VTC complex, plays a critical role in microautophagy, a process that involves direct invagination and fission of the vacuolar/lysosomal membrane under nutrient limitation . Studies have shown that deletion of the VTC complex, including VTC1, blocks microautophagic uptake into vacuoles .

Interestingly, VTC1 deletion mutants can still form autophagic tubes (specialized vacuolar membrane invaginations), but the production of microautophagic vesicles from the tips of these tubes is impaired . This suggests that VTC1, as part of the VTC complex, is specifically required for the scission of microautophagic vesicles rather than the initial formation of autophagic tubes .

The VTC complex is recruited to and concentrated on vacuoles upon induction of autophagy by nutrient limitation . It shows an inhomogeneous distribution within the vacuolar membranes, with enrichment on autophagic tubes . Affinity-purified antibodies to the VTC proteins have been shown to inhibit microautophagic uptake in reconstituted in vitro systems, further supporting the complex's direct role in this process .

What is known about the mechanism of polyphosphate channel gating in the VTC complex?

The mechanism of polyphosphate channel gating in the VTC complex has been elucidated through recent structural and functional studies . The transmembrane region of the VTC complex forms a polyphosphate-selective channel that enables the translocation of newly synthesized polyphosphate from the cytosol into the vacuolar lumen .

In the resting state, this channel adopts a conformation in which a latch-like horizontal helix of VTC4 limits the entrance . This structural feature likely serves as a gating mechanism that controls access to the channel . When activated, conformational changes occur that allow the newly synthesized polyphosphate to enter the channel and be translocated into the vacuolar lumen .

The catalytic VTC4 central domain is positioned above the pseudo-symmetric polyphosphate channel, creating a strongly electropositive pathway for nascent polyphosphate . This arrangement couples the synthesis of polyphosphate to its translocation, ensuring efficient transfer of the newly synthesized polymer into the vacuole .

The SPX domain of the catalytic VTC4 subunit positively regulates polyphosphate synthesis by the VTC complex, while the noncatalytic VTC3 regulates the complex through a phosphorylatable loop . These regulatory mechanisms, together with the structural arrangement of the channel components (including VTC1), allow for controlled gating of the polyphosphate channel in response to cellular signals such as inositol pyrophosphates .

What expression systems are most effective for producing recombinant VTC1?

For producing functional recombinant VTC1, researchers have several expression systems to choose from, each with advantages and considerations:

  • E. coli expression system:

    • E. coli BL21 has been successfully used to express His-tagged VTC1 .

    • Optimal conditions include induction with 0.5 mM IPTG at OD600 = 0.5 and expression for 5 hours at 25°C .

    • Lower expression temperatures (25°C instead of 37°C) help maintain proper protein folding, especially important for membrane proteins like VTC1 .

    • Cells should be lysed on ice by sonication in appropriate buffers (e.g., TBS with 0.5% Triton X-100) .

    • Storage in buffers containing glycerol (e.g., 10%) helps stabilize the protein .

  • Yeast expression systems:

    • For more native-like expression, S. cerevisiae itself can be used.

    • Genomic tagging of VTC proteins using PCR-based methods with plasmids like pYM-N9 has been reported, expressing the tagged proteins at their genomic locus under control of an integrated ADH promoter .

    • This approach ensures proper folding and native interactions.

When designing an expression strategy, researchers should consider:

  • Including appropriate detergents during lysis and purification for solubilizing this membrane protein.

  • Addition of protease inhibitors to prevent degradation.

  • For functional studies, co-expression with other VTC complex components might be necessary, as VTC1's function is dependent on its incorporation into the complex .

How can researchers assess VTC1's role in polyphosphate synthesis and translocation?

Assessing VTC1's role in polyphosphate synthesis and translocation requires specialized approaches since VTC1 itself does not possess catalytic activity but is essential for complex function :

  • Genetic approaches:

    • Compare polyphosphate synthesis in wild-type yeast versus VTC1 deletion mutants.

    • Complement VTC1 deletion with wild-type or mutant VTC1 to measure restoration of polyphosphate synthesis.

    • Create conditional VTC1 mutants to observe the immediate effects of VTC1 loss.

  • Biochemical assays:

    • Purify intact VTC complexes (VTC4/VTC3/VTC1 or VTC4/VTC2/VTC1) from yeast using affinity tags .

    • Perform in vitro polyphosphate synthesis assays using ATP as a substrate, with divalent cation dependence .

    • Verify synthesized polyphosphate through degradation with Ppx1, a polyphosphatase that specifically hydrolyzes polyphosphate .

    • Compare synthesis activity with ATP versus other nucleotides like GTP or CTP (the VTC complex shows strong preference for ATP) .

  • Structural and functional approaches:

    • Introduce specific mutations in VTC1 based on structural information from cryo-EM studies.

    • Assess how these mutations affect complex assembly, stability, and polyphosphate synthesis activity.

    • Use cryo-EM to visualize structural changes in the polyphosphate channel when VTC1 is mutated.

What methods are recommended for studying VTC1 interactions with other VTC complex proteins?

To study VTC1 interactions with other VTC complex proteins, researchers can employ several complementary methods:

  • Affinity purification:

    • Based on the search results, researchers have successfully used affinity tags (e.g., His-TEV-Protein A) at the C-terminus of VTC2 or VTC3 to purify endogenous VTC complexes containing VTC1 .

    • This approach allows for the isolation of intact complexes for structural and functional studies.

  • Cryo-electron microscopy:

    • Cryo-EM has been successfully used to determine the structure of the VTC complex, revealing the interactions between VTC1 and other components at high resolution (3.0-3.1 Å) .

    • This approach provides detailed structural information about the complex architecture and interfaces between subunits.

  • Protein tagging and microscopy:

    • N-terminal tagging of VTC proteins with GFP using PCR-based methods .

    • Fluorescence microscopy to visualize co-localization of VTC1 with other complex components.

    • Tracking changes in localization under different conditions (e.g., nutrient limitation) .

  • Biochemical validation:

    • Perform in vitro polyphosphate synthesis assays with reconstituted complexes to verify functional interactions .

    • Use site-directed mutagenesis to identify specific residues involved in interactions between VTC1 and other components.

    • Compare activity of complexes with wild-type versus mutant VTC1.

What are common challenges in structural studies of VTC1 and how can they be addressed?

Structural studies of VTC1, particularly as part of the VTC complex, present specific challenges that researchers should anticipate:

  • Sample preparation challenges:

    • Protein aggregation: Optimize detergent selection and concentration; consider nanodiscs that better mimic the native membrane environment; use size-exclusion chromatography to remove aggregates.

    • Complex heterogeneity: Design purification strategies that specifically isolate one complex isoform (VTC1/2/4 or VTC1/3/4); verify complex composition by mass spectrometry.

  • Cryo-EM specific issues:

    • Preferential orientation: Screen different grid types and surface treatments; add low concentrations of detergents to the buffer; try different ice thicknesses.

    • Detergent interference: Minimize excess detergent through buffer exchanges; consider detergent-free systems like amphipols or nanodiscs.

    • Beam-induced motion: Use movie mode data collection with dose fractionation; implement appropriate motion correction algorithms.

  • Model building challenges:

    • Transmembrane topology: Use complementary biochemical data on topology; consider accessibility labeling experiments to guide helix assignment.

    • Subunit identification: Use nanobodies or Fabs to label specific subunits; implement cross-linking mass spectrometry to identify proximity relationships.

  • Functional interpretation:

    • Static vs. dynamic understanding: Capture multiple functional states (e.g., with/without substrates or regulators); combine with molecular dynamics simulations.

    • Validation: Confirm key structural features through mutagenesis and functional assays.

Recent successful studies achieved 3.0-3.1 Å resolution for the VTC complex, revealing its heteropentameric architecture and the arrangement of the polyphosphate channel . These studies demonstrate that with appropriate techniques, high-quality structural data can be obtained despite the challenges.

How can researchers differentiate between direct and indirect effects when studying VTC1 function?

Differentiating between direct and indirect effects of VTC1 manipulation requires careful experimental design:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.