Recombinant Saccharomyces cerevisiae Vacuolar transporter chaperone 4 (VTC4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VTC4; PHM3; YJL012C; J1345; Vacuolar transporter chaperone 4; Phosphate metabolism protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-721
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
VTC4
Target Protein Sequence
MKFGEHLSKSLIRQYSYYYISYDDLKTELEDNLSKNNGQWTQELETDFLESLEIELDKVY TFCKVKHSEVFRRVKEVQEQVQHTVRLLDSNNPPTQLDFEILEEELSDIIADVHDLAKFS RLNYTGFQKIIKKHDKKTGFILKPVFQVRLDSKPFFKENYDELVVKISQLYDIARTSGRP IKGDSSAGGKQQNFVRQTTKYWVHPDNITELKLIILKHLPVLVFNTNKEFEREDSAITSI YFDNENLDLYYGRLRKDEGAEAHRLRWYGGMSTDTIFVERKTHREDWTGEKSVKARFALK ERHVNDFLKGKYTVDQVFAKMRKEGKKPMNEIENLEALASEIQYVMLKKKLRPVVRSFYN RTAFQLPGDARVRISLDTELTMVREDNFDGVDRTHKNWRRTDIGVDWPFKQLDDKDICRF PYAVLEVKLQTQLGQEPPEWVRELVGSHLVEPVPKFSKFIHGVATLLNDKVDSIPFWLPQ MDVDIRKPPLPTNIEITRPGRSDNEDNDFDEDDEDDAALVAAMTNAPGNSLDIEESVGYG ATSAPTSNTNHVVESANAAYYQRKIRNAENPISKKYYEIVAFFDHYFNGDQISKIPKGTT FDTQIRAPPGKTICVPVRVEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGS IGFFITSLAVLIRTVMVYAKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFCNLVA K
Uniprot No.

Target Background

Function

Vacuolar transporter chaperone 4 (VTC4) is a component of the vacuolar transporter chaperone (VTC) complex, essential for vacuolar membrane fusion. It plays a critical role in SEC18/NSF activity for SNARE priming, membrane binding of LMA1, and V(0) trans-complex formation. VTC4 binds inositol hexakisphosphate (Ins6P) and similar inositol polyphosphates, such as 5-diphospho-inositol pentakisphosphate (5-InsP7), key intracellular signaling molecules. Inositol polyphosphate binding facilitates vacuolar polyphosphate synthesis.

Gene References Into Functions
  1. Research indicates Vtc4p* functions as a polyphosphate-synthesizing enzyme. PMID: 19390046
Database Links

KEGG: sce:YJL012C

STRING: 4932.YJL012C

Protein Families
VTC4 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is VTC4 and its role in polyphosphate metabolism?

VTC4 is the catalytic subunit of the Vacuolar Transporter Chaperone (VTC) complex, a four-protein complex present in the vacuole membrane of yeasts that synthesizes inorganic polyphosphate (polyP) . PolyP is a linear polymer of orthophosphoric acid that plays important roles in microbial stress resistance, cell cycle control, and virulence . VTC4 performs polyphosphate synthesis through its phosphotransferase activity, generating polyP from ATP while releasing ADP in the presence of Mn²⁺ . The mechanism has been clarified through X-ray crystallography, revealing that the VTC4 fragment contains a long-chain electron-dense domain winding through a tunnel, with the catalytic domain facing the cytoplasm while the polymer passes through the membrane .

How is the VTC complex structured?

Recent cryo-electron microscopy has revealed that the VTC complex forms a heteropentameric architecture consisting of one VTC4, one VTC3, and three VTC1 subunits . The transmembrane region forms a polyP-selective channel, with the catalytic VTC4 central domain positioned on top of this pseudo-symmetric channel, creating a strongly electropositive pathway for nascent polyP that couples synthesis to translocation . The structure reveals a resting state conformation in which a latch-like, horizontal helix of VTC4 limits the entrance to the channel . This architectural organization provides important insights into how polyP synthesis is coordinated with its translocation across the vacuolar membrane.

What methods are effective for expressing and purifying recombinant VTC4?

Recombinant expression of VTC4 can be achieved using several approaches, depending on whether the full protein or just the catalytic core is desired. Based on established protocols:

For the catalytic domain of S. cerevisiae VTC4 (ScVtc4p189-480):

  • Amplify the catalytic domain (amino acids 189-480) using standard PCR protocols with appropriate primers containing restriction sites (e.g., SacI and PmlI)

  • Clone the fragment into an expression vector such as pQE-2

  • Transform E. coli BL21 Codon Plus (DE3)-RIPL cells with the construct

  • Induce protein expression with 0.5 M IPTG overnight at 25°C

  • Purify the histidine-tagged protein using metal-ion affinity chromatography

  • Desalt on a HiTrap column with appropriate buffer (e.g., 25 mM Tris, 200 mM NaCl, 2 mM DTT)

For native condition purification:

  • Grow recombinant E. coli in appropriate media (e.g., MagicMedia)

  • Resuspend cell pellets in lysis buffer (e.g., 50 mM sodium phosphate, pH 8.0, 0.3 M sodium chloride, 10 mM imidazole, 0.1% Triton X-100, with lysozyme and nuclease)

  • Purify using affinity chromatography with appropriate washes and elution buffers

These approaches yield functionally active recombinant protein suitable for enzymatic and structural studies.

How can polyphosphate kinase activity of recombinant VTC4 be measured?

Multiple complementary assays can be employed to measure the polyphosphate kinase activity of recombinant VTC4:

  • Fluorometric ADP/GDP determination assay:

    • Incubate purified recombinant VTC4 with ATP or GTP in buffer containing HEPES (pH 6.5), NaCl, and MnCl₂

    • Quantify ADP or GDP production using a commercial determination kit that measures fluorescence at 540/590 nm excitation/emission ratio

    • Generate a standard curve for quantification and determine kinetic parameters (Km, Vmax, kcat)

  • Coupled enzymatic assay:

    • Monitor ATP hydrolysis via NADH oxidation enzymatically coupled to the re-phosphorylation of produced ADP

    • Measure NADH concentration optically at 340 nm in buffer containing NADH, phosphoenolpyruvate, pyruvate kinase, and lactate dehydrogenase

    • Initiate reaction by adding ATP and incubate under appropriate conditions

  • Radioactive assay:

    • Detect newly synthesized polyP chains by autoradiography using [³²P]γ-ATP as substrate

    • Separate polyP by electrophoresis on Tris-borate-EDTA (TBE)-polyacrylamide gels

    • Visualize and quantify the radioactive products

Table 1: Kinetic parameters of purified recombinant VTC4 catalytic regions from different sources with various substrates

Enzyme SourceSubstrateKm (μM)Vmax (nmol/min/mg)kcat (s⁻¹)
T. brucei VTC4ATP34.9 ± 5.5188.4 ± 7.60.06
S. cerevisiae VTC4ATP6.2 ± 0.942.8 ± 1.40.02
T. brucei VTC4GTP40.0 ± 9.2145.2 ± 9.50.05
S. cerevisiae VTC4GTP11.9 ± 3.220.9 ± 1.40.01

Data adapted from kinetic parameters reported in the literature

How does VTC4 knockout affect polyphosphate levels and stress resistance in yeast?

The deletion of VTC4 (Δvtc4) in S. cerevisiae results in significantly reduced but still detectable amounts of polyphosphate. Specifically:

  • PolyP levels:

    • Acid-soluble polyPs in Δvtc4 strains reach approximately 10% of wild-type levels

    • Acid-insoluble polyPs reach approximately 20% of wild-type levels

    • This indicates that while VTC4 is the primary polyP polymerase, other mechanisms for polyP synthesis likely exist in yeast

  • Stress resistance:

    • Decreased resistance to alkaline stress, consistent with polyP's known role in pH homeostasis

    • Unexpectedly increased resistance to oxidative stress and heavy metal excess

    • The enhanced stress resistance appears to be mediated through elevated expression of DDR2 (implicated in stress response) and reduced expression of PHO84 (encoding a phosphate and divalent metal transporter)

    • Decreased Mg²⁺-dependent phosphate accumulation in Δvtc4 cells correlates with reduced expression of PHO84

These findings suggest that polyP levels play a complex role in cellular signaling for stress response mobilization in yeast, with potential feedback mechanisms that activate alternative stress response pathways when polyP synthesis is compromised .

What is the relationship between VTC4 and different polyphosphate pools in yeast?

S. cerevisiae contains several polyP pools that differ in chain length and subcellular localization . VTC4 knockout studies have revealed:

  • The Δvtc4 deletion strains lack the entire vacuolar polyP pool, confirming VTC4's essential role in vacuolar polyP synthesis

  • Multiple extraction protocols reveal that polyP fractions can be categorized based on their solubility characteristics:

    • Salt-soluble polyPs (shorter chains)

    • Alkali-soluble polyPs (longer chains)

    • The comprehensive extraction protocol developed for yeast cells provides the most complete extraction of polyP and allows obtaining separate fractions of polyPs with different chain lengths

  • NMR assays in vivo primarily detect the vacuolar polyP pool, which is most significantly affected by VTC4 deletion

  • PolyP pools differ not only in subcellular localization but also in functional roles, with evidence suggesting specialized functions for different chain-length populations

How do the SPX domain and other subunits regulate VTC4 activity?

The regulation of VTC4 activity involves multiple mechanisms and domains:

  • SPX domain regulation:

    • The SPX domain of the catalytic VTC4 subunit positively regulates polyP synthesis by the VTC complex

    • This domain likely acts as a sensor for intracellular phosphate levels, adjusting enzymatic activity in response to cellular phosphate status

  • VTC3 regulatory role:

    • The noncatalytic VTC3 subunit regulates the VTC complex through a phosphorylatable loop

    • This phosphorylation-dependent regulation provides a means for post-translational control of polyP synthesis in response to cellular signaling

  • Channel gating mechanism:

    • The structure of the VTC complex reveals a polyP-selective channel that likely adopts a resting state conformation, with a latch-like horizontal helix of VTC4 limiting the entrance

    • This suggests a gating mechanism that couples polyP synthesis to its translocation across the vacuolar membrane

  • Transmembrane architecture:

    • The membrane-integral VTC1, together with transmembrane domains of VTC2 and VTC3 proteins, forms a channel that transfers polyP into the organelle lumen

    • This structural arrangement ensures efficient delivery of newly synthesized polyP to its storage location

What methodological approaches can be used to study VTC4 structure-function relationships?

Investigating VTC4 structure-function relationships requires a multidisciplinary approach:

  • Structural biology techniques:

    • X-ray crystallography has revealed that the VTC4 fragment contains a long-chain electron-dense domain winding through a tunnel

    • Cryo-electron microscopy at high resolution (3.1 Å) has elucidated the heteropentameric architecture of the complete VTC complex

    • These techniques provide crucial insights into the spatial arrangement of domains involved in catalysis and regulation

  • Mutagenesis studies:

    • Point mutations targeting conserved basic residues of transmembrane domains can be used to assess their role in polyP synthesis and translocation

    • The Δvtc1 strain with such mutations shows reduced cellular polyP levels, confirming the importance of these residues

  • In vitro functional assays:

    • Vacuoles isolated from wild-type and mutant strains can be tested for polyP synthesis capability in vitro

    • This approach allows direct assessment of how specific mutations affect enzyme activity

  • Domain swapping and chimeric proteins:

    • Creating chimeric proteins with domains from different species' VTC4 homologs can help identify species-specific functional differences

    • For example, comparing the catalytic regions of S. cerevisiae and T. brucei VTC4 has revealed different substrate preferences and kinetic parameters

How should researchers design experiments to study VTC4's role in stress response pathways?

When investigating VTC4's role in stress response pathways, researchers should consider:

  • Strain construction and validation:

    • Generate knockout, conditional knockout, or point mutant strains using appropriate genetic techniques

    • Validate mutants by confirming reduced polyP levels using extraction protocols that capture different polyP fractions

    • Consider complementation studies by reintroducing wild-type or mutant VTC4 to confirm phenotype specificity

  • Stress exposure paradigms:

    • Test multiple stress conditions: alkaline stress, oxidative stress (e.g., H₂O₂), heavy metal exposure (e.g., Mn²⁺), osmotic stress

    • Use concentration gradients to determine stress sensitivity thresholds

    • Include appropriate positive and negative controls, including other stress response pathway mutants for comparison

  • Gene expression analysis:

    • Monitor expression of stress-responsive genes like DDR2 in VTC4 mutants compared to wild-type

    • Perform transcriptome analysis to identify compensatory pathways activated in VTC4-deficient strains

    • Validate findings with quantitative RT-PCR and protein-level measurements

  • Physiological measurements:

    • Assess phosphate uptake and accumulation using radioactive tracers

    • Measure intracellular ion concentrations, particularly calcium and magnesium

    • Monitor vacuolar pH and membrane potential in response to different stressors

  • Time-course studies:

    • Examine both acute and chronic stress responses

    • Monitor polyP levels and stress marker expression over time following stress exposure

What techniques are most effective for distinguishing between different polyphosphate fractions in VTC4 studies?

To effectively distinguish between different polyphosphate fractions when studying VTC4:

  • Sequential extraction protocols:

    • Implement a multi-stage extraction protocol that separates polyP fractions based on their solubility

    • Extract salt-soluble polyPs first, followed by alkali-soluble polyPs

    • This approach provides the most complete extraction of polyP from yeast cells and separates fractions with different chain lengths

  • Characterization of extracted fractions:

    • Analyze chain length using gel electrophoresis (TBE-PAGE)

    • Test for nucleic acid contamination to ensure purity

    • Verify polyP identity through specific enzymatic hydrolysis using exopolyphosphatase (Ppx1)

  • Subcellular fractionation:

    • Isolate vacuoles, acidocalcisomes, and other organelles to localize polyP pools

    • Perform organelle-specific polyP measurements to determine the contribution of each compartment

  • Visualization techniques:

    • Use specific polyP dyes such as DAPI (which shows a distinct emission spectrum when bound to polyP versus DNA)

    • Employ transmission electron microscopy with appropriate fixation to visualize electron-dense polyP deposits

    • Consider fluorescently labeled polyP-binding proteins as detection tools

  • Quantification methods:

    • Implement enzymatic assays that release orthophosphate from polyP for colorimetric detection

    • Use 31P-NMR spectroscopy for in vivo detection of primarily vacuolar polyP

    • Apply HPLC or ion-exchange chromatography for separation based on chain length

How can researchers address the apparent contradiction between reduced polyP and increased stress resistance in VTC4 knockout yeast?

The paradoxical finding that Δvtc4 strains with reduced polyP levels show decreased resistance to alkaline stress but increased resistance to oxidative and heavy metal stresses requires careful experimental strategies to resolve:

  • Gene expression profiling:

    • Perform comprehensive transcriptome analysis of wild-type and Δvtc4 strains under different stress conditions

    • Focus on stress-responsive genes like DDR2 that show elevated expression in Δvtc4 mutants

    • Map the regulatory networks affected by polyP depletion that might lead to compensatory stress resistance

  • Genetic interaction studies:

    • Create double mutants lacking both VTC4 and key stress response genes

    • Analyze epistatic relationships to determine whether the enhanced stress resistance in Δvtc4 strains depends on specific stress response pathways

    • Create VTC4/PHO84 double mutants to test whether reduced PHO84 expression mediates the increased heavy metal resistance

  • Metal uptake and accumulation measurements:

    • Quantify cellular uptake and accumulation of heavy metals using ICP-MS or radioactive tracers

    • Test whether reduced PHO84 expression in Δvtc4 strains leads to decreased manganese uptake, potentially explaining the enhanced resistance

    • Measure intracellular metal distributions across different cellular compartments

  • Signal transduction analysis:

    • Investigate the phosphorylation status of stress-responsive transcription factors

    • Determine whether polyP itself acts as a signaling molecule or buffer for stress response

    • Examine whether artificially introducing polyP into Δvtc4 cells rescues the wild-type stress response phenotype

  • Evolutionary perspective:

    • Analyze whether this apparently contradictory response represents an evolved compensatory mechanism

    • Compare polyP metabolism and stress responses across different yeast species and strains

What methodological considerations explain variations in reported polyphosphate levels in VTC4 mutants?

The literature reports varying levels of residual polyP in Δvtc4 mutants, from complete absence to significant residual amounts . These variations can be explained by several methodological considerations:

  • Extraction method specificity:

    • Different extraction protocols have varying efficiencies for different polyP pools

    • Some studies report complete absence of vacuolar polyP in Δvtc4 strains while others detect residual amounts (10-20% of wild-type levels)

    • Multi-stage extraction protocols that separate polyP fractions based on solubility provide more comprehensive assessment

  • Detection sensitivity:

    • Newer, more sensitive detection methods may identify residual polyP missed by older techniques

    • Consider limits of detection when comparing across studies

    • Enzymatic verification using specific polyP-degrading enzymes like Ppx1 confirms the identity of detected polymers

  • Strain background differences:

    • Genetic background of S. cerevisiae strains can influence polyP metabolism

    • Document complete strain information when reporting polyP levels

    • Consider complementation studies to confirm phenotypes are directly attributable to VTC4 deletion

  • Growth conditions impact:

    • Phosphate availability in growth media dramatically affects polyP accumulation

    • Standardize and explicitly report media composition and growth conditions

    • Consider time-course studies as polyP levels fluctuate during growth phases

  • Alternative polyP synthesis pathways:

    • Investigate whether VTC4-independent polyP synthesis occurs under specific conditions

    • Examine potential compensatory upregulation of other enzymes in Δvtc4 strains

    • Consider double or triple knockout studies involving multiple VTC complex components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.