Recombinant Saccharomyces exiguus Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae COX2

Recombinant S. cerevisiae Cytochrome c oxidase subunit 2 (COX2) is a mitochondrial membrane protein involved in the electron transport chain. It is a critical component of Complex IV (cytochrome c oxidase), where it facilitates electron transfer from cytochrome c to molecular oxygen. The recombinant version is produced in E. coli with an N-terminal His tag for purification (Creative Biomart, ).

ParameterDetails
GeneCOX2 (mitochondrial gene, locus P00410)
Expression SystemE. coli
TagN-terminal His tag
Amino Acid Range16-251aa (full-length precursor protein)
Molecular FunctionElectron transfer, copper center coordination, proton translocation

2.1. Role of the COX2 mRNA 5’-Untranslated Leader (5’-UTL)

  • Mutations in the 5’-UTL (cox2-11, cox2-12, cox2-13) disrupt translation efficiency and respiratory growth without affecting mRNA stability. Suppressor mutations in the nuclear gene PET111 partially restore translation, indicating direct interaction between PET111 and the 5’-UTL ( ).

2.2. Conserved Aromatic Residues and Electron Transfer

  • Trp-56 and Gly-58 in COX2’s aromatic region are essential for electron transfer to the CuA center. Substitutions (e.g., W56R) reduce cytochrome c oxidase activity and destabilize the enzyme complex ( ).

2.3. Mitochondrial vs. Cytosolic Synthesis

  • Mitochondrially synthesized COX2 shows reduced activity compared to cytoplasmically synthesized and imported versions. This is attributed to inefficient folding or limited chaperone access in the mitochondrial matrix ( ).

2.4. Copper Homeostasis and COX2 Maturation

  • Dmo2p, a mitochondrial inner membrane protein, interacts with COX2 and copper chaperones (Sco1p, Sco2p). Deletion of DMO2 reduces COX2 stability and cytochrome c oxidase activity, highlighting its role in copper incorporation ( ).

3.2. Leader Peptide Function

  • The 15-amino-acid leader peptide encoded by mitochondrial COX2 mRNA is critical for translation regulation. Deletions in the coding sequence (e.g., cox2-22) reduce protein accumulation, but suppressor mutations in nuclear genes (e.g., MRPL36) restore translation ( ).

Comparative Analysis of COX2 Variants

VariantExpression SystemActivityKey ObservationSource
Wild-type COX2Mitochondrial100%Stable CuA center assembly
W56R mutant (cytosolic)E. coli~60%Reduced CcO stability; inefficient import
Δ5’-UTL (cox2-11)Mitochondrial30%PET111-dependent translational suppression
dmo2Δ mutantMitochondrial<10%Impaired copper incorporation into COX2

Implications for Biotechnology

  • Protein Engineering: The W56R mutation enables cytosolic expression but highlights trade-offs between hydrophobicity and functionality.

  • Copper Homeostasis: Dmo2p and Sco proteins are potential targets for enhancing COX2 maturation in recombinant systems.

  • Translational Regulation: PET111 and mRNA 5’-UTL interactions could optimize mitochondrial protein synthesis in engineered strains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
14-249
Protein Length
Full Length of Mature Protein
Species
Saccharomyces exiguus (Yeast)
Target Names
COX2
Target Protein Sequence
DVPTPYGFYFQDSATPNQEGILELHDNIMFYLVVILGLVSWMLFTIVRTYSRNPMAYKYI KHGQTIEIIWKIFPAVILLTIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYFDFIN DNGETIEFESYVIPDSLLEEGQLRLLDTDTSIVVPVDTHIRFIVTAADVIHDFAIPSLGI KVDGTPGRLNQVSTLIQREGVFYGMCSELCGIGHAQMPIKVEAVSLPKFLEWLNEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a crucial component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a vital process in cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work collaboratively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC, comprising heme A3 and CuB in subunit 1). The BNC then reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of COX2 in the respiratory chain?

Cytochrome c oxidase subunit 2 (COX2) serves as a critical component of the respiratory chain, specifically carrying the metal center that functions as the initial acceptor of electrons from cytochrome c. This electron transfer initiates the cascade that ultimately reduces molecular oxygen to water. The subunit contains conserved aromatic regions that facilitate electron transfer from the copper center in subunit II to the remaining metal centers located in subunit I of the cytochrome oxidase complex . This electron transfer pathway is essential for cellular respiration and energy production in the form of ATP through oxidative phosphorylation.

How does the structure of S. exiguus COX2 compare to other yeast species?

While specific structural data for S. exiguus COX2 is limited, comparative analyses with other yeast species, particularly Saccharomyces cerevisiae, reveal high conservation in the core functional domains. Like other yeast cytochrome c oxidase subunits, S. exiguus COX2 likely maintains structural homology with its counterparts in related species. Homology modeling based on bovine subunits suggests that yeast COX2 contains two transmembrane helices positioned similarly along the primary sequence . The metal-binding sites and electron transfer pathways show strong conservation across species, although subtle structural differences may exist that could affect functional efficiency or regulatory mechanisms in different environmental conditions.

What are the key conserved domains in COX2 that researchers should focus on?

Researchers should focus on several highly conserved domains in COX2 that are critical for function:

  • The aromatic region containing five aromatic and three non-aromatic amino acids that is conserved across diverse organisms

  • Metal-binding sites, particularly those coordinating the copper center (CuA site)

  • Residues involved in the interaction with cytochrome c

  • Transmembrane domains that anchor the protein in the mitochondrial membrane

  • Regions involved in subunit assembly with other components of the cytochrome c oxidase complex

These conserved domains are essential for electron transfer, protein-protein interactions, and maintaining the structural integrity necessary for proper enzymatic function.

What are the optimal methods for expressing recombinant S. exiguus COX2 in heterologous systems?

For optimal expression of recombinant S. exiguus COX2, researchers should consider the following methodological approach:

  • Vector Selection: Use expression vectors with strong, inducible promoters such as pCMV6-XL6 for mammalian expression or yeast-specific vectors for homologous expression .

  • Host Selection:

    • For bacterial expression: Modified E. coli strains capable of handling membrane proteins, with selection using ampicillin (100 μg/mL)

    • For yeast expression: S. cerevisiae strains with deletions in the endogenous COX2 gene to prevent interference

  • Expression Optimization:

    • Temperature: 28-30°C for yeast expression

    • Induction: Gradual induction protocols to allow proper folding

    • Media supplementation: Copper and other metal ions to facilitate proper cofactor incorporation

  • Purification Strategy:

    • Affinity tags: Consider adding a histidine tag to facilitate purification, as demonstrated with Cox13 in S. cerevisiae

    • Detergent selection: Critical for maintaining structure during membrane protein extraction

    • Chromatography steps: Sequential purification using ion exchange followed by size exclusion

This approach addresses the challenges of expressing a mitochondrial membrane protein while maintaining its functional characteristics.

How should researchers design mutation studies to investigate the electron transfer function of COX2?

When designing mutation studies to investigate electron transfer function in COX2, researchers should follow this structured approach:

  • Target Selection:

    • Focus on conserved aromatic residues, particularly tryptophan residues implicated in electron transfer

    • Consider glycine residues that may provide structural flexibility

    • Target amino acids that form the copper-binding site

  • Mutation Strategy:

    • Conservative substitutions: Replace aromatic residues with other aromatics to assess specific side chain requirements

    • Non-conservative changes: Test functional impact of dramatic alterations

    • Multiple mutations: Introduce combined mutations to detect synergistic effects

  • Functional Assays:

    • Cellular respiration measurements

    • Growth rates on non-fermentable carbon sources

    • Direct enzyme activity assays for cytochrome c oxidase

    • Electron transfer kinetics using spectroscopic methods

  • Structural Verification:

    • Confirm proper protein folding and assembly

    • Verify metal center incorporation using spectroscopic techniques

This design allows systematic evaluation of structure-function relationships in COX2, particularly regarding electron transfer mechanisms.

What approaches are most effective for studying COX2 assembly into the cytochrome c oxidase complex?

Studying COX2 assembly requires multifaceted approaches:

  • Genetic Tools:

    • Creation of temperature-sensitive mutants that affect assembly

    • Development of strains with regulatable expression of assembly factors

    • Introduction of tagged versions of assembly proteins to track interactions

  • Biochemical Methods:

    • Blue native gel electrophoresis to identify assembly intermediates

    • Co-immunoprecipitation to detect protein-protein interactions

    • Pulse-chase experiments to track the kinetics of assembly

  • Microscopy Techniques:

    • Fluorescently-tagged COX2 to visualize localization

    • Super-resolution microscopy to examine assembly complexes

    • Electron microscopy to visualize structural details

  • Assembly Factor Analysis:

    • Focus on interactions with Mss51, which has dual functions in Cox1 translation and early assembly steps

    • Investigate dependencies on other components of the OXPHOS system that influence assembly

This comprehensive approach allows researchers to dissect the complex, regulated process of COX2 incorporation into functional cytochrome c oxidase.

How should researchers interpret growth defects in yeast strains with COX2 mutations?

Interpreting growth defects in yeast strains with COX2 mutations requires careful analysis:

  • Growth Phenotype Characterization:

    • Compare growth rates on fermentable versus non-fermentable carbon sources

    • Establish temperature sensitivity profiles (25°C, 30°C, 37°C)

    • Assess response to oxidative stress inducers

  • Correlation Analysis Framework:

    Mutation TypeGrowth on GlucoseGrowth on Glycerol/EthanolCytochrome c Oxidase ActivityInterpretation
    Null effectNormalNormal>80% of wild-typeNon-critical residue
    Assembly defectNormalSeverely impaired<10% of wild-typeProtein unstable/not assembled
    Catalytic defectNormalModerately impaired10-50% of wild-typeFunctional but less efficient
    Regulatory defectNormalConditionally impairedVariable/condition-dependentRegulatory function affected
  • Secondary Mutation Analysis:

    • Identify revertants that restore respiratory growth

    • Map secondary compensatory mutations to identify functional interactions between residues

    • Use these pairs to establish structure-function relationships

  • Integration with Biochemical Data:

    • Correlate growth defects with specific enzyme activity measurements

    • Analyze cytochrome c oxidase spectroscopic properties

    • Examine assembly state using protein analysis techniques

This systematic interpretation approach allows researchers to distinguish between mutations affecting assembly, catalytic function, or regulatory roles of COX2.

What statistical approaches are recommended for analyzing electron transfer kinetics in wild-type versus mutant COX2?

For analyzing electron transfer kinetics, researchers should employ these statistical approaches:

  • Kinetic Data Analysis:

    • Fit electron transfer rates to appropriate kinetic models (first-order, second-order)

    • Calculate rate constants (k) and compare across mutants

    • Determine activation energies (Ea) using Arrhenius plots

  • Statistical Tests:

    • Use paired t-tests for comparing wild-type and single mutant data

    • Employ ANOVA with post-hoc tests (Tukey's or Bonferroni) for comparing multiple mutants

    • Apply non-parametric tests (Mann-Whitney U) when normal distribution cannot be assumed

  • Advanced Analytical Methods:

    • Principal Component Analysis (PCA) to identify patterns across multiple mutants

    • Hierarchical clustering to group mutations with similar effects

    • Correlation analysis between structural features and kinetic parameters

  • Validation Approaches:

    • Bootstrap resampling to estimate confidence intervals

    • Cross-validation techniques to test predictive models

    • Sensitivity analysis to identify critical parameters

These statistical approaches provide robust frameworks for distinguishing meaningful differences in electron transfer kinetics between wild-type and mutant forms of COX2.

How do the metal binding sites in S. exiguus COX2 compare with those in other species?

The metal binding sites in COX2 show evolutionary conservation with some species-specific variations:

  • Copper Center (CuA) Comparison:

    • Core ligands (histidine and cysteine residues) are strictly conserved across species

    • The CuA site in yeast COX2 maintains the same dinuclear copper center structure as in bovine and bacterial homologs

    • Subtle differences in second-sphere residues may tune the redox potential

  • Comparative Metal Binding Properties:

    SpeciesCuA LigandsAdditional Metal SitesRedox PotentialStructural Features
    S. exiguus (predicted)H181, C216, C220, M227, H224*Similar to S. cerevisiaeNot determinedBased on homology model
    S. cerevisiaeConserved with bovineMg2+ site conservedSimilar to bovinePredicted from homology model
    BovineH161, C196, C200, M207, H204Mg2+, Ca2+/Na+ sites+240 mVDetermined by X-ray crystallography
    BacterialSimilar core ligandsFewer additional sitesMore variableMore structural variation

    *Note: Exact residue numbers for S. exiguus are predicted based on homology

  • Functional Implications:

    • Conservation of metal centers suggests preservation of fundamental electron transfer mechanisms

    • Species variations likely reflect adaptations to different environmental conditions or metabolic requirements

    • The questionable presence of the Ca2+/Na+ site in yeast (due to amino acid differences at positions equivalent to bovine Q43 and S441) may indicate different regulatory mechanisms

This comparative analysis provides insights into both the fundamental conservation and species-specific adaptations of metal binding sites in COX2.

What can researchers learn from comparing mutations in S. exiguus COX2 with those in S. cerevisiae and mammalian systems?

Comparative mutation analysis across species offers valuable insights:

  • Evolutionary Conservation Analysis:

    • Identify absolutely conserved residues across all species (likely essential for function)

    • Map species-specific variations that might reflect environmental adaptations

    • Determine residues that co-evolve, suggesting functional coupling

  • Cross-Species Mutation Effects:

    • Mutations in conserved aromatic residues (like tryptophan) show similar effects on electron transfer across species

    • Assembly-disrupting mutations in core regions have consistent phenotypes

    • Species-specific differences in suppressor mutations can reveal alternative compensatory mechanisms

  • Therapeutic Relevance:

    • S. exiguus mutations that mirror human pathological variants can serve as models for mitochondrial diseases

    • Differences in mutation effects between species can highlight alternative therapeutic pathways

    • Compensatory mutations identified in yeast may suggest strategies for genetic interventions in human disease

  • Structure-Function Evolution:

    • Compare the structural impacts of mutations across the phylogenetic tree

    • Identify how functional domains have adapted while preserving core activities

    • Map interaction networks that differ between species

This comparative approach transforms single-species observations into broader evolutionary insights that enhance our understanding of COX2 function across different organisms.

What are the most effective protocols for introducing site-directed mutations in mitochondrial COX2 genes?

Introducing site-directed mutations in mitochondrial genes requires specialized approaches:

  • Yeast Mitochondrial Transformation System:

    • Biolistic transformation (gene gun) of isolated mitochondria

    • Co-transformation with a mitochondrial marker gene (e.g., ARG8m)

    • Selection on appropriate media to identify transformants

    • Verification of homoplasmy through multiple rounds of selection

  • Genetic Engineering Strategy:

    • Creation of a modified yeast strain where deleterious mutations in mtDNA are counter-selected

    • Design of specific genetic tests to identify and map mutations in COX1, COX2, or COX3 genes

    • Use of synthetic mitochondrial genes with optimized codons

    • Application of CRISPR-based approaches adapted for mitochondrial genomes

  • Mutation Design Considerations:

    • Plan silent mutations to create restriction sites for screening

    • Design mutations in clusters to study interacting residues

    • Consider the impact on mRNA stability and translation efficiency

    • Ensure mutations don't disrupt splicing in intron-containing genes

  • Verification Methods:

    • PCR amplification followed by sequencing

    • Restriction fragment length polymorphism analysis

    • Phenotypic screening on non-fermentable carbon sources

    • Functional assays to confirm impact on cytochrome c oxidase activity

These methodological approaches overcome the challenges of manipulating the mitochondrial genome, allowing precise genetic modifications of COX2 for functional studies.

How can researchers effectively purify and characterize recombinant COX2 for structural studies?

For effective purification and characterization of recombinant COX2:

  • Optimized Purification Strategy:

    • Affinity purification using histidine tags (as demonstrated with Cox13 in S. cerevisiae)

    • Detergent selection critical for membrane protein stability (DDM, LMNG, or digitonin)

    • Lipid supplementation to maintain native-like environment

    • Blue native PAGE to verify intact complex formation

  • Structural Characterization Techniques:

    • Cryo-electron microscopy for high-resolution structure determination

    • X-ray crystallography following optimization of crystal formation conditions

    • Hydrogen/deuterium exchange mass spectrometry for dynamics studies

    • Circular dichroism to assess secondary structure integrity

  • Functional Verification:

    • Oxygen consumption measurements to confirm activity

    • Spectroscopic analysis of metal centers

    • Electron transfer kinetics using stopped-flow techniques

    • Thermal stability assays to assess folding quality

  • Quality Control Parameters:

    ParameterAcceptable RangeMethod of DeterminationSignificance
    Purity>95%SDS-PAGE, Size exclusion chromatographyEnsures homogeneous preparation
    Copper content1.8-2.0 mol/molAtomic absorption spectroscopyConfirms metal center integrity
    Specific activity>80% of native enzymeOxygen electrode measurementsVerifies functional state
    Thermal stabilityTm >45°CDifferential scanning calorimetryIndicates proper folding
    Secondary structureSimilar to native proteinCircular dichroismConfirms structural integrity

This comprehensive approach ensures that purified recombinant COX2 maintains its native structure and function, making it suitable for high-resolution structural studies and accurate functional characterization.

What are the future research directions for S. exiguus COX2 studies?

The future of S. exiguus COX2 research presents several promising directions:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.