Recombinant Saccharomyces pastorianus Protein RER1 (RER1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces pastorianus Protein RER1 (RER1)

Saccharomyces pastorianus, a hybrid yeast species resulting from the combination of Saccharomyces cerevisiae and Saccharomyces eubayanus, is widely used in the production of lager-style beers due to its ability to ferment at low temperatures . Recombinant Saccharomyces pastorianus Protein RER1 (RER1), also known as Retention of ER proteins 1, is a protein that plays a crucial role in the retrieval of endoplasmic reticulum (ER) membrane proteins from the early Golgi compartment. RER1 is essential for the correct localization of proteins such as SEC12, SEC71, and SEC63 within the endoplasmic reticulum .

Function and Mechanism of RER1

RER1 functions as a key component in the retrieval mechanism of ER membrane proteins, ensuring their retention within the ER . It acts by retrieving these proteins from the cis-Golgi back to the ER . This is crucial for maintaining the proper function of the ER and the efficient trafficking of proteins within the cell .

RER1 appears to be a limiting component in the retrieval machinery for ER membrane proteins . Studies have shown that RER1 is required for the correct localization of multiple ER membrane proteins, regardless of their topology .

RER1 Homologues and Localization

The human homologue of yeast Rer1p has been identified and characterized . The human Rer1 protein shares significant sequence identity and similarity to yeast Rer1 protein . Functional studies have demonstrated that human Rer1 can complement the RER1 deletion in S. cerevisiae, reducing the mislocalization of the Sec12-reporter protein .

Subcellular localization studies have shown that human Rer1 protein is primarily localized to the Golgi apparatus and peripheral elements of the ER-Golgi interface . Overexpression of human Rer1 can lead to its relocation to ER-like structures and affect the structural organization of the Golgi apparatus .

RER1 and the COPI Complex

The COPI complex, is essential for retrograde transport from the Golgi to the ER . Mutations in COPI subunits can disrupt the localization of ER membrane proteins, including those dependent on RER1 . Studies have shown that a mutation in alpha-COP, a subunit of yeast coatomer, can cause mislocalization of Mfalpha1p fusions of Sec12p, Sec71p, and Sec63p . These observations suggest that RER1 and coatomer play general roles in ER membrane protein localization .

RER1 Availability

Recombinant Saccharomyces pastorianus Protein RER1 is available for purchase from several suppliers, including Cusabio and THE BioTek . It is produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells . The protein is available in partial form and with different tags, depending on the supplier and expression system.

RER1 Data Table

FeatureDescription
NameRecombinant Saccharomyces pastorianus Protein RER1 (RER1)
SynonymsRetention of ER proteins 1, Protein RER1
Source OrganismSaccharomyces pastorianus (Saccharomyces cerevisiae x Saccharomyces eubayanus)
FunctionRetrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment, ensuring their retention within the ER
Subcellular LocationGolgi apparatus membrane; Multi-pass membrane protein
RoleLocalization of SEC12, SEC71, and SEC63 within the endoplasmic reticulum
Expression SystemsYeast, E. coli, Baculovirus, Mammalian cell
Purity>85% (SDS-PAGE)
HomologuesHuman Rer1 (shares 44% sequence identity and 65% similarity to yeast Rer1 protein)
Involved InGolgi-to-ER trafficking
Interaction PartnersSec12p, Sec71p, Sec63p, Rsp5 ubiquitin ligase, COPI complex

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RER1; Protein RER1; Retention of ER proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Saccharomyces pastorianus (Lager yeast) (Saccharomyces cerevisiae x Saccharomyces eubayanus)
Target Names
RER1
Target Protein Sequence
MDYDSPDPMNGASSNALIAKMNSAKLLYQHYLDKVTPHAKQRWAVLGGLLCLFMVRITMA EGWYVICYGLGLFLLNQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKF WYNSIRATVISLVLSLFSIFDIPVFWPILLMYFVLLFFLTMRRQIQHMMKYRYIPLDIGK KKYSHPSN
Uniprot No.

Target Background

Function

Recombinant Saccharomyces pastorianus Protein RER1 (RER1) is involved in retrieving endoplasmic reticulum (ER) membrane proteins from the early Golgi compartment. It is essential for the correct localization of SEC12, SEC71, and SEC63 within the ER.

Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the optimal storage condition for Recombinant Saccharomyces pastorianus Protein RER1?

For optimal stability and longevity of Recombinant Saccharomyces pastorianus Protein RER1, storage conditions depend on the protein formulation. Lyophilized RER1 maintains stability for approximately 12 months when stored at -20°C/-80°C, while the liquid form has a shorter shelf life of about 6 months at the same temperature range . To prevent degradation from repeated freeze-thaw cycles, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week . The stability of the protein is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself.

What is the recommended reconstitution protocol for lyophilized RER1 protein?

The recommended reconstitution protocol involves:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (standard is 50%)

  • Aliquoting for long-term storage at -20°C/-80°C

This protocol helps maintain protein stability and activity while minimizing degradation during storage.

What is the structural characterization of human RER1 protein?

Human RER1 is an integral membrane protein consisting of 196 amino acids with four putative transmembrane domains that form an M-shaped topology . Both the N- and C-termini face the cytosol . The protein exhibits structural and functional conservation across species, as evidenced by the ability of human RER1 to complement the RER1 deletion mutant in Saccharomyces cerevisiae . The functional region of RER1 includes a hydrophilic loop between transmembrane domains 2 and 3 (amino acids 89-120), which has been used to generate antibodies for research purposes .

How can RER1 function be studied in cellular trafficking experiments?

To investigate RER1's role in cellular trafficking, researchers should implement multi-faceted approaches:

  • Expression Modulation Systems:

    • Overexpression studies using RER1-Myc tagged constructs in mammalian expression vectors

    • RNA interference (siRNA) for RER1 knockdown to assess loss-of-function effects

  • Subcellular Localization Analysis:

    • Immunofluorescence microscopy using antibodies against RER1 (such as R75 and R76 polyclonal antibodies)

    • Co-localization studies with ER, Golgi, and secretory pathway markers

  • Protein-Protein Interaction Assessment:

    • Co-immunoprecipitation assays to identify RER1 binding partners

    • Proximity ligation assays to confirm interactions in situ

Research has shown that RER1 associates with γ-secretase in early secretory compartments and regulates its intracellular trafficking . Overexpression of RER1 decreases γ-secretase localization on the cell surface, while RER1 knockdown increases the level of cell surface γ-secretase . These experimental approaches can help elucidate the mechanisms by which RER1 functions in protein trafficking.

What methodologies are effective for investigating RER1's role in neurodegenerative disease models?

To study RER1's impact on neurodegenerative pathologies, particularly in relation to alpha-synuclein and amyloid-beta pathology, the following methodologies are recommended:

  • In vitro cellular models:

    • Neural cell cultures expressing disease-associated proteins (alpha-synuclein, APP)

    • RER1 overexpression/knockdown coupled with quantification of protein aggregation

  • Viral vector approaches:

    • AAV or lentiviral vectors for RER1 expression in affected brain regions

    • Stereotactic delivery methods for targeted expression in animal models

  • Quantitative assessments:

    • ELISA-based quantification of secreted amyloid-beta or alpha-synuclein

    • Western blot analysis of mature vs. immature APP levels

    • Cell surface biotinylation assays to measure protein trafficking to plasma membrane

  • Functional outcomes:

    • Behavioral testing in animal models following RER1 manipulation

    • Neuropathological assessment of protein aggregation and neurodegeneration

Research has demonstrated that RER1 expression reduces alpha-synuclein levels in cell and neuron cultures , and that RER1 overexpression decreases both γ-secretase localization on the cell surface and Aβ secretion .

How should researchers design experiments to study the interaction between RER1 and the γ-secretase complex?

When investigating RER1-γ-secretase interactions, consider the following experimental design elements:

  • Binding site identification:

    • Generate truncation mutants of RER1 to map interaction domains

    • Create chimeric proteins to determine binding specificity

    • Utilize site-directed mutagenesis for point mutations at predicted interface regions

  • Functional impact assessment:

    • Measure γ-secretase activity using fluorogenic substrates following RER1 manipulation

    • Quantify secreted Aβ peptides using specialized ELISAs

    • Assess APP processing through western blot analysis of APP C-terminal fragments

  • Trafficking dynamics:

    • Implement live-cell imaging with fluorescently tagged RER1 and γ-secretase components

    • Perform subcellular fractionation to track protein movement between compartments

    • Use endoH/PNGase F digestion to assess glycosylation status and trafficking progression

Previous studies have identified RER1 as a binding partner of different γ-secretase subunits, including Nicastrin (NCT) and Presenilin enhancer 2 (PEN2) . RER1 affects γ-secretase assembly by regulating retention or retrieval of γ-secretase subunits, highlighting the importance of proper experimental design to delineate these complex interactions.

What expression systems are optimal for producing functional recombinant RER1 protein?

The selection of expression systems for RER1 production requires careful consideration of protein folding, post-translational modifications, and membrane integration requirements:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid growthLimited post-translational modifications, challenges with membrane proteinsProduction of soluble domains, GST-fusion proteins for antibody generation
Yeast (S. cerevisiae)Natural host for S. pastorianus RER1, proper folding environmentLower yields than bacteriaFunctional studies requiring native-like protein
Mammalian cellsAuthentic post-translational modifications, proper membrane integrationHigher cost, longer production timeStudies on trafficking, protein-protein interactions
Insect cellsHigh expression levels, post-translational modificationsModerate costStructural studies, large-scale production

What purification strategies yield the highest purity for recombinant RER1?

Achieving high purity RER1 preparations (>85% by SDS-PAGE ) requires strategic purification approaches:

  • Initial extraction:

    • For membrane proteins like RER1, detergent selection is critical

    • Mild detergents (DDM, CHAPS) preserve protein structure

    • Optimize detergent concentration through small-scale extractions

  • Multi-step purification protocol:

    • Affinity chromatography using tagged constructs (His, GST, etc.)

    • Ion exchange chromatography for charge-based separation

    • Size exclusion chromatography as a polishing step

  • Quality control assessments:

    • SDS-PAGE with Coomassie/silver staining for purity estimation

    • Western blotting for identity confirmation

    • Mass spectrometry for molecular weight verification

    • Circular dichroism for secondary structure analysis

How can researchers utilize RER1 to study mechanisms of neurodegenerative diseases?

RER1's involvement in protein trafficking makes it a valuable target for understanding neurodegenerative disease mechanisms:

  • Parkinson's disease research:

    • Investigate RER1's effect on alpha-synuclein accumulation and aggregation

    • Test whether viral expression of RER1 in the brain can reduce alpha-synuclein pathology

    • Explore the mechanistic relationship between RER1, alpha-synuclein processing, and neurodegeneration

  • Alzheimer's disease applications:

    • Study RER1's role in regulating APP trafficking and processing

    • Investigate how RER1-mediated retention of γ-secretase affects Aβ production

    • Develop potential therapeutic strategies targeting RER1 to modulate Aβ generation

  • Experimental models:

    • Transgenic animals with modified RER1 expression

    • Patient-derived iPSCs differentiated into relevant neural types

    • Organoid models mimicking disease pathology

Research has shown that RER1 influences the trafficking and localization of both γ-secretase and APP, thereby regulating the production and secretion of Aβ peptides . These findings suggest that targeting RER1 could represent a novel approach for modulating pathogenic protein accumulation in neurodegenerative diseases.

What methods can be used to investigate RER1 function in hybrid yeast species like Saccharomyces pastorianus?

Studying RER1 in the hybrid brewing yeast S. pastorianus presents unique challenges and opportunities:

  • Genomic considerations:

    • S. pastorianus contains DNA from both S. cerevisiae and S. bayanus

    • Different strains contain varying ratios of parental genomes

    • Group 1 strains contain approximately one genome each of S. cerevisiae and S. bayanus

    • Group 2 strains contain approximately two genomes of S. cerevisiae and one genome of S. bayanus

  • Genetic engineering approaches:

    • CRISPR-Cas9 editing targeting specific "landing sites" on chimeric chromosomes

    • Integration of expression cassettes at safe genomic locations

    • Selection of appropriate promoters for target expression levels

  • Functional analysis methods:

    • Complementation studies using RER1-deficient yeast strains

    • Protein localization studies comparing parental and hybrid species

    • Trafficking assays to assess differences in secretory pathway function

The unique genomic architecture of S. pastorianus requires careful consideration when designing experiments, particularly when targeting genes that may be present in multiple copies or different versions from each parental genome.

How can protein-protein interaction networks involving RER1 be comprehensively mapped?

To elucidate the complete interactome of RER1, researchers should employ complementary approaches:

  • Unbiased screening methods:

    • Yeast two-hybrid screening with RER1 as bait

    • Proximity-dependent biotin identification (BioID)

    • APEX2-based proximity labeling

    • Immunoprecipitation coupled with mass spectrometry

  • Validation techniques:

    • Co-immunoprecipitation with specific antibodies

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Surface plasmon resonance for quantitative binding measurements

  • Network analysis:

    • Pathway enrichment analysis of identified interactors

    • Comparison with known secretory pathway components

    • Functional clustering of interaction partners

RER1 has been identified as an interactor with γ-secretase components including Nicastrin (NCT) and Presenilin enhancer 2 (PEN2) . A comprehensive understanding of RER1's interaction network would provide valuable insights into its diverse roles in cellular trafficking and disease pathways.

How might RER1 be utilized in developing novel therapeutic approaches for neurodegenerative diseases?

RER1's role in protein trafficking presents several potential therapeutic avenues:

  • Therapeutic targeting strategies:

    • Small molecule modulators of RER1-substrate interactions

    • Peptide-based inhibitors mimicking binding interfaces

    • Gene therapy approaches to increase RER1 expression in affected tissues

  • Disease-specific applications:

    • For Parkinson's disease: Enhancing RER1 activity to reduce alpha-synuclein accumulation

    • For Alzheimer's disease: Modulating RER1-mediated retention of γ-secretase to reduce Aβ production

  • Delivery considerations:

    • Viral vectors (AAV, lentiviral) for CNS delivery

    • Blood-brain barrier penetration strategies for small molecules

    • Cell-based delivery systems (stem cells expressing RER1)

The Michael J. Fox Foundation is currently supporting research to test whether viral expression of RER1 in the brain can reduce alpha-synuclein pathology and associated neurodegeneration in pre-clinical models of parkinsonism . If successful, this approach could lead to the development of new drugs targeting RER1 for treatment of Parkinson's disease.

What comparative approaches can reveal evolutionary insights about RER1 function across species?

To understand RER1's evolutionary conservation and functional divergence:

  • Comparative genomic analyses:

    • Sequence alignment of RER1 homologs across evolutionary distant species

    • Identification of conserved domains and species-specific adaptations

    • Synteny analysis to examine genomic context conservation

  • Functional complementation studies:

    • Cross-species rescue experiments in RER1-deficient backgrounds

    • Domain-swapping between homologs to identify functional regions

    • Heterologous expression studies to assess trafficking differences

  • Structural biology approaches:

    • Comparative modeling of RER1 structures across species

    • Conservation mapping onto predicted structural elements

    • Molecular dynamics simulations to assess functional movements

Human RER1 has been shown to complement the RER1 deletion mutant of Saccharomyces cerevisiae , indicating functional conservation across large evolutionary distances. This conservation suggests that findings from model organisms may be applicable to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.