Recombinant Saccharophagus degradans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics and Biochemical Features

Recombinant Saccharophagus degradans ATP synthase subunit a (atpB) is a bacterial F₀ sector subunit critical for proton translocation and ATP synthesis. This subunit is part of the ATP synthase complex, which generates ATP through oxidative phosphorylation. The recombinant version is engineered for expression in E. coli and includes an N-terminal His tag for purification and downstream applications .

Key Attributes

ParameterDescription
Protein Length1–250 amino acids (full-length)
Molecular Weight~28 kDa (estimated)
TagN-terminal His tag for affinity chromatography
Expression SystemE. coli

Sequence and Structural Insights
The amino acid sequence of atpB from S. degradans includes conserved motifs critical for proton channel formation and ATP synthase activity. Alignment with homologs from other bacteria (e.g., E. coli) reveals high conservation in transmembrane domains responsible for ion transport .

Production and Purification

The recombinant protein is produced via bacterial expression systems optimized for yield and solubility. Key steps include:

  1. Cloning: Insertion of the atpB gene into a plasmid vector.

  2. Expression: Induction of protein synthesis in E. coli under controlled conditions.

  3. Purification: Affinity chromatography using nickel or cobalt columns to exploit the His tag .

Domain Organization

  • Transmembrane Domains: Critical for proton channel formation.

  • Cytoplasmic Domains: Interact with F₁ sector subunits to drive ATP synthesis.

Research Gaps and Future Directions

  1. Functional Studies: Limited data exist on the kinetic properties (e.g., proton-to-ATP stoichiometry) of S. degradans atpB.

  2. Structural Biology: Crystallographic or cryo-EM studies are needed to resolve its 3D structure and interactions with other ATP synthase subunits.

  3. Industrial Applications: Potential roles in bioenergy production or synthetic biology remain unexplored.

References

  1. Creative Biomart. Recombinant Full Length ATP Synthase Subunit A (atpB) Protein, His-Tagged. [Online]. Available: https://www.creativebiomart.net/recombinant-full-length-atp-synthase-subunit-a-atpb-protein-his-tagged-544953.htm.

  2. Colorectal Research. ELISA Recombinant Saccharophagus degradans ATP Synthase Subunit a (atpB). [Online]. Available: https://www.colorectalresearch.com/shop/csb-cf637458saax-elisa-recombinant-saccharophagus-degradans-atp-synthase-subunit-a-atpb-155090.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; Sde_3972; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Target Names
atpB
Target Protein Sequence
MASSEELTATGYIQHHLQNLTYGKLPAGYVRHNADGTHTELAANTWTFAHTAQEAKDMGF MAVHVDTLGWGIFLALLLGFIFRSAVKKAHTGKPSGLLSFVEFLVEGINSVVKDIFHHKN RLIAPMGLTIFSWVFMMNLMDLIPVDWLPMLAQVVTGDSHTFFKVVPTTDPNATLGMAFT VFALMIMFSIKEKGALGFVKELTCHPFFAPKKLWYLNILLIPVNTILETVALIAKPISLG LRLFGNMYAGEMIFILIALLFSVGLVMGFVGGVLQWAWAVFHILVITLQAFIFMVLTTVY MAMAHDNHDEH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Saccharophagus degradans and why is it significant for research?

Saccharophagus degradans is a versatile marine carbohydrate-degrading bacterium belonging to the Gammaproteobacteria. It was formally classified as a new genus and species (Saccharophagus degradans gen. nov., sp. nov.) based on 16S rRNA gene sequence similarity and phenotypic analyses. S. degradans strain 2-40(T) is particularly noteworthy for its remarkable ability to degrade at least 10 different complex polysaccharides, including agar, alginate, chitin, cellulose, fucoidan, laminarin, pectin, pullulan, starch, and xylan . This versatility in carbohydrate degradation makes it an organism of significant interest for biotechnological applications and comparative studies of metabolic pathways. S. degradans shares approximately 90.5% 16S rRNA gene sequence similarity with Microbulbifer hydrolyticus and 91.5% with Teredinibacter turnerae, but can be distinguished by its broader substrate utilization capacity, lower G+C content, and differences in fatty acid composition .

What is ATP synthase and what role does the a subunit (atpB) play in its function?

ATP synthase (F₁F₀-ATPase) is a universal enzyme complex that functions as a biological nanomotor, catalyzing ATP synthesis from ADP and inorganic phosphate (Pi) using the energy of an electrochemical gradient of protons or sodium ions. This enzyme is extraordinarily conserved across organisms and is found in the plasma membranes of bacteria, thylakoid membranes of chloroplasts, and inner membranes of mitochondria .

How does recombinant Saccharophagus degradans ATP synthase subunit a differ from those in other organisms?

While specific comparative data for S. degradans ATP synthase subunit a (atpB) is limited in the provided search results, we can infer certain characteristics based on the general properties of ATP synthases and the unique nature of S. degradans as a marine bacterium.

S. degradans ATP synthase likely displays adaptations to marine environments, potentially including salt tolerance mechanisms and structural modifications that enable function under varying marine conditions. The ATP synthase in S. degradans may also have unique amino acid sequences that reflect its evolutionary adaptation to marine ecological niches .

Comparative sequence analysis with ATP synthase subunits from related bacteria such as Microbulbifer species would likely reveal specific sequence variations that could correlate with functional differences. Additionally, as a bacterium with extraordinary carbohydrate-degrading capabilities, S. degradans may have energy requirements that influence the regulation and activity of its ATP synthase complex.

What are the optimal expression systems for producing recombinant S. degradans ATP synthase subunit a?

The choice of expression system for recombinant S. degradans ATP synthase subunit a (atpB) should be guided by several factors, including protein folding requirements, post-translational modifications, and intended experimental applications.

Based on comparative studies of recombinant protein expression, several systems warrant consideration:

For membrane proteins like ATP synthase subunit a, expression should be carefully optimized considering:

  • Selection of appropriate detergents for protein extraction and purification

  • Codon optimization for the host organism

  • Use of fusion tags to enhance solubility and facilitate purification

  • Expression temperature and induction conditions

The kinetics of protein production also varies during different growth phases, with some proteins produced at higher rates during glucose metabolism while others during alternative carbon source utilization, such as ethanol .

What structural features of the S. degradans ATP synthase subunit a are critical for catalytic activity?

While specific structural data for S. degradans ATP synthase subunit a is not directly provided in the search results, we can extrapolate from known structural features of ATP synthase in other organisms.

The a subunit contains several transmembrane helices that form part of the proton channel through the membrane. Critical functional regions likely include:

  • Arginine finger: A conserved arginine residue in the a subunit is essential for proton translocation, forming part of the mechanism that converts proton movement into rotational energy.

  • Proton half-channels: The a subunit typically contains two half-channels that allow protons to access the critical residues on the c-ring, facilitating proton movement across the membrane.

  • Interface with c-ring: The interaction surface between the a subunit and the rotating c-ring is crucial for function, with specific residues forming a tight but dynamic seal that prevents proton leakage.

  • Lipid-binding regions: As a membrane protein, the a subunit likely contains specific regions that interact with membrane lipids, which can influence protein stability and function.

Changes in these critical regions through site-directed mutagenesis could provide valuable insights into the specific functions of different structural elements of the S. degradans ATP synthase a subunit.

How do inhibitors interact with the ATP synthase complex, and what does this reveal about the function of subunit a?

ATP synthase has approximately twelve discrete inhibitor binding sites, with multiple natural and synthetic inhibitors targeting different parts of the complex . The study of inhibitor interactions can reveal crucial functional aspects of the a subunit:

  • Oligomycin binding: This inhibitor binds in the F₀ sector and blocks proton conduction. Oligomycin resistance mutations often map to the a and c subunits, highlighting their role in proton translocation .

  • Other F₀ inhibitors: Compounds like venturicidin and dicyclohexylcarbodiimide (DCCD) target the proton translocation machinery, with binding sites that often involve the a subunit, revealing details about proton pathway structure.

  • Structure-function relationships: Inhibitor binding studies can reveal conformational changes in the a subunit during catalysis, providing insights into how proton movement is coupled to rotation of the c-ring.

The study of inhibitor resistance mutations specifically in the a subunit can map critical functional residues. Additionally, comparing inhibitor sensitivity across species can highlight unique features of the S. degradans ATP synthase that may relate to its marine environment adaptation.

What are the recommended protocols for isolating and purifying recombinant S. degradans ATP synthase subunit a?

The isolation and purification of membrane proteins like ATP synthase subunit a requires specialized approaches:

  • Membrane protein extraction:

    • Begin with cell lysis under conditions that preserve membrane integrity

    • Use a two-phase extraction with selective detergents (e.g., DDM, LMNG, or digitonin)

    • Optimize detergent-to-protein ratios to maintain protein structure and function

  • Purification strategy:

    • Affinity chromatography using engineered tags (His, FLAG, etc.)

    • Size exclusion chromatography to separate individual subunits or complexes

    • Ion exchange chromatography for further purification

  • Functional verification:

    • ATPase activity assays to confirm enzymatic function

    • Proton pumping assays using reconstituted proteoliposomes

    • Structural analysis through cryo-EM or crystallography if the entire complex is purified

The purification process must carefully balance the need for purity with the maintenance of structural integrity and function. Temperature, pH, salt concentration, and detergent choice all significantly impact purification success.

What experimental approaches can be used to study the interaction between subunit a and other components of the ATP synthase complex?

Several complementary approaches can elucidate the interactions between subunit a and other components of the ATP synthase complex:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify residues in close proximity between subunit a and other subunits, particularly the c-ring.

  • FRET analysis: Fluorescence resonance energy transfer using specifically labeled subunits can provide dynamic information about subunit interactions during catalysis.

  • Cryo-electron microscopy: This technique can resolve structural details of the intact complex, revealing the precise positioning of subunit a relative to other components.

  • Mutational analysis: Systematic mutagenesis of residues in subunit a, followed by functional assays, can identify critical interaction sites.

  • Molecular dynamics simulations: Computational approaches can model the dynamic interactions between subunits based on available structural data.

  • Co-immunoprecipitation: This technique can identify stable interactions between subunit a and other components under different physiological conditions.

By combining these approaches, researchers can build a comprehensive understanding of how subunit a contributes to the structure and function of the ATP synthase complex.

How can researchers assess the functional integrity of recombinant S. degradans ATP synthase subunit a?

Functional assessment of recombinant ATP synthase subunit a involves several complementary approaches:

  • Reconstitution experiments:

    • Incorporation of purified subunit a into proteoliposomes with other ATP synthase components

    • Measurement of proton pumping activity using pH-sensitive dyes

    • Assessment of ATP synthesis driven by artificially imposed proton gradients

  • Structural integrity tests:

    • Circular dichroism spectroscopy to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal stability assays to evaluate protein stability

  • Binding assays:

    • Interaction studies with known inhibitors specific to the F₀ sector

    • Measurement of subunit a association with other ATP synthase components

  • In vivo complementation:

    • Expression of recombinant S. degradans subunit a in ATP synthase-deficient strains

    • Assessment of respiration, growth, and ATP production in complemented strains

These methods together provide a comprehensive evaluation of whether the recombinant protein retains its native structure and function, which is critical for subsequent experimental applications.

What is the role of Pi binding in ATP synthase function and how does this relate to subunit a?

Inorganic phosphate (Pi) binding is crucial for ATP synthesis and has important implications for understanding the entire ATP synthase mechanism, including the function of subunit a:

Pi binding in the catalytic sites of ATP synthase involves several specific residues including αPhe-291, αSer-347, αGly-351, αArg-376, βLys-155, βArg-182, βAsn-243, βArg-246, and others in the αVISIT-DG sequence . This binding is "energy-linked," meaning it is directly connected to subunit rotation and the proton translocation mechanism .

The relationship between Pi binding and subunit a function involves:

  • Energy coupling: Proton movement through subunit a drives rotation of the c-ring, which is transmitted to the central shaft (γ subunit), causing conformational changes in the catalytic sites that promote tight Pi binding.

  • Conformational changes: The binding of Pi at the catalytic site creates a preference for ADP binding over ATP binding, which is essential for the synthetic direction of the reaction despite higher cellular concentrations of ATP than ADP .

  • Sequence coordination: The proton movement through subunit a must be precisely coordinated with the Pi binding events in the catalytic sites to achieve efficient energy coupling.

Understanding these relationships can guide the development of novel inhibitors targeting specific aspects of ATP synthase function, including the proton translocation machinery involving subunit a .

How do mutations in the ATP synthase subunit a contribute to disease states and what does this reveal about structure-function relationships?

Mutations in ATP synthase subunit a have been associated with various disease states, providing valuable insights into structure-function relationships:

  • Leigh syndrome: This neurodegenerative disease can result from mutations in the a subunit of ATP synthase, highlighting the critical role of this subunit in maintaining proper mitochondrial function . These mutations typically affect proton translocation efficiency, resulting in decreased ATP production.

  • Bioenergetic dysfunction: Other mutations in subunit a can cause less severe but still significant impairments in energy production, contributing to various mitochondrial disorders characterized by tissue-specific energy deficits.

  • Structural insights: Disease-causing mutations often cluster in specific regions of the a subunit, revealing functionally critical domains:

    • Mutations affecting proton half-channels disrupt proton movement

    • Mutations at the interface with the c-ring can uncouple proton movement from rotation

    • Mutations affecting membrane integration can destabilize the entire complex

  • Therapeutic implications: Understanding the specific effects of subunit a mutations guides the development of potential therapeutic approaches, including:

    • Small molecules that may bypass specific defects

    • Gene therapy approaches targeting the affected subunit

    • Metabolic interventions that provide alternative energy sources

How can recombinant S. degradans ATP synthase subunit a be utilized in drug development research?

Recombinant S. degradans ATP synthase subunit a offers several applications in drug development research:

  • Antimicrobial target validation: S. degradans ATP synthase represents a potential target for new antimicrobial agents. The a subunit, with its essential role in proton translocation, provides a specific target site for inhibitor development. For example, the tuberculosis drug diarylquinoline targets mycobacterial ATP synthase, with resistance mutations mapping to the c subunit (D32V and A63P) , suggesting similar approaches could be developed for other bacterial ATP synthases.

  • Screening platform: Purified recombinant subunit a or reconstituted ATP synthase complexes containing this subunit can serve as platforms for high-throughput screening of potential inhibitors, including:

    • Natural products like polyphenols (resveratrol, piceatannol, quercetin, morin, epicatechin)

    • Synthetic compounds targeting membrane protein interfaces

    • Peptide-based inhibitors designed to disrupt specific protein-protein interactions

  • Structure-based drug design: Detailed structural information about subunit a can guide rational design of inhibitors targeting specific functional regions, such as:

    • Proton channels

    • Interface with c-ring

    • Critical residues for proton translocation

  • Comparative studies: Differences between bacterial and human ATP synthase a subunits can be exploited to develop selective antimicrobial agents with minimal host toxicity.

The unique properties of S. degradans as a marine bacterium may also provide insights into developing compounds that function effectively in specialized environments.

What are the key challenges in expressing and studying ATP synthase subunits, and how can they be overcome?

Researchers face several challenges when working with ATP synthase subunits, particularly membrane-embedded components like subunit a:

  • Expression challenges:

    • Membrane protein toxicity to host cells during overexpression

    • Proper membrane insertion and folding

    • Formation of inclusion bodies

    Solutions:

    • Use of specialized expression strains with enhanced membrane protein handling

    • Controlled expression using tunable promoters

    • Co-expression with chaperones to assist folding

    • Expression as fusion proteins with solubility-enhancing tags

  • Purification challenges:

    • Maintaining membrane protein stability during extraction

    • Preventing aggregation

    • Separating individual subunits while preserving structure

    Solutions:

    • Screening multiple detergents for optimal extraction

    • Addition of lipids during purification to maintain native environment

    • Use of nanodiscs or amphipols to stabilize membrane proteins

    • Gentle purification conditions with minimal temperature fluctuations

  • Functional assessment challenges:

    • Difficulty in reconstituting single subunits into functional complexes

    • Distinguishing effects of individual subunits in a multi-subunit complex

    Solutions:

    • Development of partial complex reconstitution approaches

    • Use of chimeric proteins combining regions from different organisms

    • Site-specific labeling for tracking individual subunits

  • Structural analysis challenges:

    • Obtaining sufficient quantities of properly folded protein

    • Crystallization difficulties with membrane proteins

    Solutions:

    • Cryo-EM approaches that require less protein and no crystallization

    • Use of antibody fragments to stabilize specific conformations

    • Computational modeling based on partial structural data

By addressing these challenges methodically, researchers can enhance the study of ATP synthase subunits and advance understanding of their structure and function.

How does S. degradans ATP synthase compare to ATP synthases from other bacterial species?

S. degradans ATP synthase can be compared to other bacterial ATP synthases across several dimensions:

Table 1: Comparative Features of ATP Synthases Across Bacterial Species

FeatureS. degradansE. coliMycobacterium tuberculosisThermophilic bacteria
Environmental adaptationMarine environmentMesophilicIntracellular pathogenHigh temperature
Primary ionH⁺ (predicted)H⁺H⁺H⁺ or Na⁺
Inhibitor sensitivityUnknown*Sensitive to oligomycin, DCCDSensitive to diarylquinolineVariable
Unique structural featuresLikely adaptations for marine environmentWell-characterizedMutations in c subunit (D32V, A63P) confer drug resistance Enhanced thermal stability
Genomic contextAssociated with carbohydrate degradation systems Standard arrangementSpecialized arrangement for intracellular survivalHeat-shock response elements

*Specific inhibitor sensitivity data for S. degradans ATP synthase is not provided in the search results.

While specific structural details of S. degradans ATP synthase are not fully characterized in the provided search results, its classification as a unique genus separate from Microbulbifer and Teredinibacter suggests potential adaptations in its energy production systems . The remarkable versatility of S. degradans in degrading complex carbohydrates may be reflected in specialized energy production mechanisms, potentially including unique features in its ATP synthase complex.

What insights can be gained from studying the ATP synthase epsilon chain (atpC) in relation to the a subunit (atpB)?

While the search results focus more on the epsilon chain (atpC) rather than subunit a (atpB), studying these components in relation to each other can provide valuable insights:

By studying these components together, researchers can develop a more comprehensive understanding of the structural and functional relationships within the ATP synthase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.