Recombinant Saccharophagus degradans Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Saccharophagus degradans DsbB (UniProt ID: Q21EN9) is a 166-amino-acid membrane protein expressed in Escherichia coli with an N-terminal His-tag for purification . Key specifications include:

PropertyDetails
Expression HostE. coli
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional 50% glycerol for long-term storage

The amino acid sequence includes redox-active cysteine residues critical for disulfide bond catalysis:
Sequence:
MKITKLPSYRQTALIIFAGCVGLILAALYMQEVLGLHPCPLCITQRIFIIGVGLISLIAAIHNPAALGRKVYGCLATLSGVIGAGVSARHVWLQNLPEDQVPACGPDLAYMFDAFPLLDALKLLFAGDGNCADVVASFLGLSIPGWTFVAFVGLIAISVWQGLRKA

Functional Mechanism

DsbB is an integral membrane oxidoreductase that regenerates the periplasmic oxidase DsbA, enabling disulfide bond formation in secreted proteins . Its mechanism involves:

  • Transmembrane Architecture: Four α-helices anchor DsbB in the membrane, with two periplasmic loops containing catalytic cysteine pairs (Cys41-Cys44 and Cys104-Cys130) .

  • Redox Cycling:

    1. DsbA transfers electrons to DsbB, forming an intermolecular disulfide bond with Cys104 .

    2. Electrons are relayed to ubiquinone via Cys41-Cys44, regenerating DsbB’s active site .

  • Quinone Interaction: The Cys41-Cys44 disulfide reacts with membrane-embedded quinones, linking oxidative protein folding to the respiratory chain .

Protein Stabilization

  • Horseradish Peroxidase (HRP): Coexpression of DsbB with DsbA, DsbC, and DsbD in E. coli increases HRP periplasmic yield 11-fold by correcting disulfide bonds and reducing aggregation .

  • Half-Life Extension: HRP stability rises from 25 minutes to 120 minutes when DsbB is overexpressed .

Water-Soluble Variants

Engineered soluble DsbB (SxDsbBΔC GZ) retains quinone-dependent activity in the cytoplasm, enabling disulfide bond formation in cytoplasmic proteins like PhoA . This innovation bypasses membrane localization constraints, broadening biotechnological utility.

Industrial Challenges

  • Inclusion Body Mitigation: Overexpression of DsbB reduces misfolded protein aggregates by enhancing oxidative folding, critical for high-yield recombinant protein production .

Future Directions

Recent advances in solubilizing DsbB while retaining activity open avenues for cytoplasmic disulfide bond engineering. Further studies are needed to optimize its synergy with isomerases like DsbC for complex eukaryotic protein production.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; Sde_3585; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Target Names
dsbB
Target Protein Sequence
MKITKLPSYRQTALIIFAGCVGLILAALYMQEVLGLHPCPLCITQRIFIIGVGLISLIAA IHNPAALGRKVYGCLATLSGVIGAGVSARHVWLQNLPEDQVPACGPDLAYMFDAFPLLDA LKLLFAGDGNCADVVASFLGLSIPGWTFVAFVGLIAISVWQGLRKA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It acts by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of DsbB in bacterial redox systems?

DsbB serves as a crucial membrane enzyme in the disulfide bond formation pathway of bacterial systems. Its primary function is to reoxidize the periplasmic dithiol oxidase DsbA after DsbA transfers its disulfide to substrate proteins. DsbB becomes reduced during this interaction with DsbA and is subsequently reoxidized by transferring electrons to membrane-bound quinones, completing the electron transport chain that powers disulfide bond formation . This oxidative enzymatic process is critical for proper protein folding and function in the bacterial periplasm. The catalytic mechanism involves specific cysteine residues that participate in thiol-disulfide exchange reactions, forming transient mixed disulfides between DsbB and its substrates .

How does the structure of DsbB facilitate its electron transfer function?

The crystal structure of DsbB in complex with DsbA and ubiquinone provides valuable insights into its functional mechanism. DsbB contains multiple transmembrane domains with strategically positioned cysteine residues that participate in disulfide exchange reactions. The structure reveals that cysteine relocation occurs during the reaction cycle, which prevents backward resolution of the complex and allows Cys130 to approach and activate the disulfide-generating reaction center composed of Cys41, Cys44, Arg48, and ubiquinone . This arrangement facilitates the directional flow of electrons from DsbA to DsbB to ubiquinone. The interaction with ubiquinone is particularly important, as it serves as the final electron acceptor in this pathway, converting DsbB into a "superoxidizing enzyme" capable of oxidizing the highly oxidizing DsbA .

What experimental approaches are recommended for initial characterization of recombinant Saccharophagus degradans DsbB?

For initial characterization, researchers should consider a multi-faceted approach:

  • Sequence analysis: Perform comparative sequence alignment with well-characterized DsbB proteins from model organisms like Escherichia coli to identify conserved catalytic residues.

  • Expression system optimization: Due to its membrane protein nature, expression in specialized E. coli strains designed for membrane protein production is recommended, with systematic testing of induction conditions (temperature, inducer concentration, and duration).

  • Purification strategy: Utilize a two-step purification approach combining affinity chromatography (His-tag) followed by size exclusion chromatography in the presence of appropriate detergents to maintain protein stability.

  • Activity assays: Establish an in vitro system to measure DsbB's ability to oxidize DsbA using fluorescence-based assays that track the redox state of DsbA's cysteines.

  • Redox potential determination: Determine the redox potential of the active site cysteines using equilibrium techniques with glutathione redox buffers of known potential.

These approaches provide a foundation for understanding the basic properties of recombinant S. degradans DsbB before proceeding to more advanced studies .

How might S. degradans DsbB differ from homologous proteins in other bacterial species?

S. degradans DsbB likely possesses unique characteristics reflecting its adaptation to a marine environment and its role in the degradation of complex polysaccharides. When comparing DsbB across bacterial species, several important differences may emerge:

CharacteristicE. coli DsbBPredicted S. degradans DsbBSignificance
Redox potential-207 mVPotentially modified for marine environmentAffects electron transfer efficiency
Quinone specificityUbiquinone (aerobic), menaquinone (anaerobic)Potentially adapted to fluctuating oxygen conditionsReflects metabolic adaptations
Salt toleranceModerateLikely high (marine bacterium)Adaptation to natural habitat
Temperature optimum37°CPotentially lowerReflection of marine environment
Substrate specificityPrimarily DsbAMay have expanded specificityRelated to diverse protein substrates

These differences would reflect S. degradans' evolutionary adaptation to its ecological niche. Research should focus on identifying unique residues that might confer these specialized properties, particularly in the quinone-binding region and at interfaces with partner proteins .

What is the relationship between DsbB and the ScsB protein family in terms of evolutionary history and functional divergence?

DsbB and ScsB represent distinct but related families of membrane electron transporters that have diverged to perform opposite roles in bacterial redox homeostasis. While DsbB participates in oxidative pathways, ScsB (similar to DsbD) functions in reductive pathways. Evolutionary analysis suggests these proteins share a distant common ancestor but have specialized for different functions:

  • DsbB works with DsbA to catalyze disulfide bond formation by transferring electrons to quinones .

  • ScsB, like DsbD, functions as an electron hub that dispatches electrons received from the cytoplasmic thioredoxin system to periplasmic oxidoreductases .

The domain organization of ScsB resembles that of DsbD, but with significant differences in the amino-terminal domain. This suggests that ScsB acts on a different array of substrates compared to both DsbB and DsbD . Studying the relationship between these protein families in S. degradans could provide insights into how redox pathways have evolved and specialized in this organism, particularly in relation to its unique ecological niche and metabolic capabilities.

How might the peroxide reduction pathway discovered in other bacteria relate to potential redox functions in S. degradans?

Recent research has identified a peroxide reduction pathway in the periplasm of Caulobacter crescentus, comprising a thioredoxin-like protein (TlpA) and a peroxiredoxin (PprX), which receives electrons from the ScsB membrane transporter . This discovery suggests that S. degradans might possess similar mechanisms to handle oxidative stress in its cell envelope.

For S. degradans, which degrades complex polysaccharides in marine environments, such a periplasmic peroxide reduction system could be particularly important for several reasons:

  • Protection during biomass degradation, which may generate reactive oxygen species

  • Defense against oxidative stress in variable marine conditions

  • Maintenance of proper redox conditions for the numerous secreted enzymes involved in polysaccharide degradation

Researchers investigating S. degradans should consider:

  • Identifying potential peroxiredoxins in the S. degradans genome that might function in the periplasm

  • Determining whether S. degradans has homologs of the TlpA and PprX proteins discovered in C. crescentus

  • Investigating how the DsbB oxidative pathway might be coordinated with periplasmic reductive pathways

This would contribute to understanding how S. degradans maintains redox homeostasis in its periplasmic space while actively degrading complex organic materials in marine environments.

What approaches should be used to express and purify recombinant S. degradans DsbB for structural studies?

Successful expression and purification of membrane proteins like DsbB present significant challenges. Based on approaches used for related proteins, the following protocol is recommended for recombinant S. degradans DsbB:

  • Construct design:

    • Include an N-terminal pelB signal sequence to direct the protein to the membrane

    • Add a C-terminal 6×His or 10×His tag for purification

    • Consider fusion partners like GFP to monitor expression and folding

  • Expression system:

    • Use specialized E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) designed for membrane protein expression

    • Culture in rich media (TB or 2×YT) supplemented with 0.2% glucose

    • Induce at lower temperatures (16-20°C) with reduced IPTG concentration (0.1-0.4 mM)

    • Extend expression time (16-24 hours) to enhance proper folding

  • Membrane preparation:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membranes to remove peripheral proteins

  • Solubilization and purification:

    • Solubilize membranes using mild detergents (DDM, LMNG, or C12E8)

    • Purify using IMAC (immobilized metal affinity chromatography)

    • Apply size exclusion chromatography for final purification

    • Consider lipid supplementation throughout purification

  • Quality assessment:

    • Evaluate protein homogeneity by SDS-PAGE and size exclusion chromatography

    • Verify activity using a DsbA oxidation assay

    • Assess thermal stability using differential scanning fluorimetry

This methodological approach maximizes the likelihood of obtaining properly folded and functional recombinant DsbB suitable for structural studies .

How can researchers assess the functional integrity of recombinant S. degradans DsbB in vitro?

To verify that recombinant S. degradans DsbB retains its native function after expression and purification, several complementary assays can be employed:

  • DsbA oxidation assay:

    • Prepare reduced DsbA with its active site cysteines in the dithiol form

    • Monitor the rate of DsbA oxidation in the presence of purified DsbB and ubiquinone

    • Track reaction progress using fluorescence (tryptophan quenching occurs upon DsbA oxidation) or by alkylation of free thiols followed by SDS-PAGE

  • Ubiquinone reduction assay:

    • Measure the reduction of ubiquinone spectrophotometrically at 275 nm

    • Calculate the rate of electron transfer from DsbB to ubiquinone

  • Oxygen consumption assay:

    • In a coupled system with reduced DsbA, DsbB, and quinone, measure oxygen consumption as an indirect indicator of electron transfer activity

    • Use an oxygen electrode to quantify the rate

  • Reconstitution into proteoliposomes:

    • Incorporate purified DsbB into liposomes to better mimic its native membrane environment

    • Assess activity using the above assays to determine if membrane incorporation enhances function

  • Thermal stability assessment:

    • Use differential scanning fluorimetry to determine if purified DsbB exhibits a cooperative unfolding transition expected for properly folded proteins

    • Compare stability in different detergents and lipid environments

These functional assays provide comprehensive validation of recombinant DsbB activity, ensuring that subsequent structural or mechanistic studies are conducted with physiologically relevant protein .

What techniques are most effective for analyzing the interaction between recombinant S. degradans DsbB and its redox partners?

Characterizing the interactions between DsbB and its redox partners requires specialized techniques that can capture these often transient interactions:

  • Co-immunoprecipitation with cysteine trapping:

    • Generate DsbB variants with strategic cysteine mutations that trap mixed disulfide intermediates with partner proteins

    • Use co-immunoprecipitation followed by mass spectrometry to identify interaction partners

  • Surface plasmon resonance (SPR):

    • Immobilize purified DsbB on a sensor chip

    • Measure binding kinetics and affinity constants for purified interaction partners (e.g., DsbA)

    • Evaluate how mutations in either protein affect interaction parameters

  • Isothermal titration calorimetry (ITC):

    • Determine thermodynamic parameters of binding between DsbB and partners

    • Quantify enthalpy, entropy, and stoichiometry of interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map interaction interfaces by identifying regions of DsbB that show altered hydrogen-deuterium exchange rates when bound to partners

    • Provide insights into conformational changes upon binding

  • Cross-linking coupled with mass spectrometry:

    • Use chemical cross-linkers to capture transient interactions

    • Identify cross-linked peptides by mass spectrometry to map interaction sites

  • Förster resonance energy transfer (FRET):

    • Label DsbB and interaction partners with appropriate fluorophores

    • Monitor protein-protein interactions in real-time

    • Particularly useful for measuring the kinetics of association and dissociation

These techniques, applied in combination, provide a comprehensive characterization of the interaction network of S. degradans DsbB, helping to elucidate its role in the cellular redox homeostasis system .

How should researchers interpret differences in kinetic parameters of DsbB across bacterial species?

When comparing kinetic parameters of DsbB from different bacterial species, including S. degradans, researchers should consider multiple factors that influence these differences:

  • Environmental adaptation factors:

    • Temperature optima reflecting natural habitat (mesophilic, thermophilic, psychrophilic)

    • pH dependence related to the organism's ecological niche

    • Salt concentration effects, particularly relevant for marine organisms like S. degradans

  • Structural basis for kinetic differences:

    • Variations in active site residues that may modify redox potential

    • Differences in quinone-binding pocket architecture affecting electron transfer efficiency

    • Alterations in protein dynamics that influence substrate recognition and catalysis

  • Physiological context:

    • Differences in cellular redox balance requirements

    • Varying substrate proteins requiring disulfide bond formation

    • Relationship to other redox systems in the cell

  • Standardized analysis framework:

    • Use consistent experimental conditions when possible for direct comparisons

    • Apply enzyme kinetics models appropriate for membrane proteins

    • Consider developing correction factors to normalize for detergent effects

The interpretation should integrate these parameters to develop a comprehensive understanding of how evolutionary pressures have shaped DsbB function in different organisms, particularly in relation to their cellular redox requirements and environmental challenges .

What experimental controls are critical for studies of S. degradans DsbB redox activity?

Rigorous controls are essential for accurate interpretation of S. degradans DsbB redox activity data:

  • Negative controls:

    • Catalytically inactive DsbB mutants (e.g., with cysteine-to-alanine substitutions)

    • Reactions lacking essential components (ubiquinone, DsbA)

    • Heat-denatured enzyme preparations

  • Positive controls:

    • Well-characterized DsbB from model organisms (e.g., E. coli DsbB)

    • Standardized oxidation/reduction reactions with known kinetic parameters

    • Chemical oxidants/reductants with defined redox potentials

  • System validation controls:

    • Verification of protein folding and stability under experimental conditions

    • Confirmation of detergent micelle size and homogeneity

    • Assessment of potential interfering components in reagents

  • Environmental variable controls:

    • Temperature dependence measurements

    • pH profile determination

    • Salt concentration effects, particularly important for marine-derived proteins

  • Specificity controls:

    • Cross-reactions with alternative substrates

    • Competition assays with known partners

    • Assessment of non-specific redox reactions

These controls ensure that observed activities are specifically attributable to properly folded and functional S. degradans DsbB, allowing confident interpretation of experimental results and meaningful comparisons with homologous proteins from other species .

How might understanding S. degradans DsbB contribute to our knowledge of bacterial adaptation to marine environments?

S. degradans is a marine bacterium specialized in degrading complex polysaccharides, and its DsbB protein likely reflects adaptations to this unique ecological niche. Studying S. degradans DsbB can provide insights into:

  • Redox adaptations in marine bacteria:

    • Marine environments present unique oxidative challenges due to high salt concentrations, variable oxygen levels, and UV exposure

    • S. degradans DsbB might possess specialized features for maintaining disulfide bond formation under these conditions

    • Comparative analysis with terrestrial bacterial DsbB proteins could reveal marine-specific adaptations

  • Support for extracellular enzyme function:

    • S. degradans secretes numerous enzymes containing disulfide bonds for degrading complex polysaccharides

    • The DsbB-DsbA system likely plays a critical role in ensuring proper folding of these secreted enzymes

    • Understanding DsbB function could explain how S. degradans maintains efficient extracellular degradative capacity

  • Coordination with periplasmic stress responses:

    • Marine bacteria face unique periplasmic stresses, including osmotic challenges and oxidative stress

    • The disulfide bond formation system may be integrated with other stress response pathways

    • S. degradans might possess novel periplasmic redox homeostasis mechanisms similar to the peroxide reduction pathway identified in C. crescentus

This research direction could yield valuable insights into how bacteria adapt their fundamental cellular processes to thrive in challenging marine environments, with potential applications in understanding marine microbial ecology and enzyme evolution .

What insights might crystallographic studies of S. degradans DsbB provide compared to existing structures from other bacteria?

Crystallographic studies of S. degradans DsbB would be highly valuable for comparative structural biology, potentially revealing:

  • Specialized structural adaptations:

    • The crystal structure of E. coli DsbA-DsbB-ubiquinone complex revealed key features of the reaction mechanism, including cysteine relocation that prevents backward resolution of the complex

    • S. degradans DsbB structure might show adaptations that optimize function in marine environments, such as:

      • Modified quinone-binding pocket architecture

      • Altered surface charge distribution for function in high salt

      • Unique interaction interfaces with partner proteins

      • Structural elements conferring increased stability

  • Mechanistic insights:

    • Potential capture of different conformational states during the catalytic cycle

    • Structural basis for any altered substrate specificity

    • Details of electron flow pathways through the protein

  • Evolutionary perspectives:

    • Structural comparison with DsbB from diverse bacteria would illuminate evolutionary conservation and divergence

    • Potential identification of marine-specific structural motifs

    • Insights into adaptation of a fundamental redox system across ecological niches

  • Biotechnological applications:

    • Structural information could guide protein engineering for enhanced stability or modified specificity

    • Design of inhibitors targeting bacterial disulfide bond formation pathways

    • Development of DsbB variants optimized for biotechnological applications

These structural insights would complement the existing knowledge base represented by the E. coli DsbA-DsbB-ubiquinone complex structure and provide a more comprehensive understanding of the structural diversity within this important protein family .

What are the key future research directions for S. degradans DsbB studies?

Future research on S. degradans DsbB should focus on several promising directions:

  • Functional characterization in native context:

    • Development of genetic tools for S. degradans to create DsbB knockout and complementation strains

    • Assessment of the impact of DsbB disruption on polysaccharide degradation capacity

    • Identification of the full complement of proteins dependent on DsbB-mediated disulfide bond formation

  • Integration with marine bacterial redox networks:

    • Investigation of potential peroxide reduction pathways in S. degradans similar to those discovered in C. crescentus

    • Characterization of ScsB homologs in S. degradans and their relationship to DsbB function

    • Mapping the complete redox homeostasis network in the periplasm

  • Structural and mechanistic studies:

    • Determination of the S. degradans DsbB structure alone and in complex with partners

    • Elucidation of the full catalytic cycle through capture of intermediate states

    • Comparative analysis with homologs from diverse ecological niches

  • Biotechnological applications:

    • Engineering S. degradans DsbB for enhanced production of disulfide-bonded proteins

    • Exploration of unique properties that might be valuable for industrial applications

    • Development of inhibitors targeting bacterial disulfide bond formation pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.