Recombinant Saccharophagus degradans Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

MsbA is an ATP-binding cassette (ABC) transporter responsible for flipping lipid A—a key component of lipopolysaccharides (LPS)—from the cytoplasmic to the periplasmic leaflet of the inner membrane . In Saccharophagus degradans, recombinant MsbA retains this essential function, enabling LPS assembly and outer membrane biogenesis . Its role in lipid transport makes it a target for antibiotic development .

Lipid A Transport Mechanism

  • MsbA adopts inward-facing (IF) and outward-facing (OF) conformations during transport .

  • Lipid A binds deeply within the transmembrane cavity, stabilized by interactions with charged residues (e.g., Arg78, Lys299) .

  • ATP hydrolysis drives conformational changes, enabling lipid A flipping .

ATPase Activity

  • ATPase activity is lipid-dependent: Stimulated ~2.5-fold by Kdo2-lipid A .

  • Mutations (e.g., R78A/K299A) disrupt lipid binding and abolish ATPase stimulation .

Production and Purification

The recombinant protein is produced via:

  1. Expression: Codon-optimized msbA gene expressed in E. coli .

  2. Solubilization: Membranes solubilized with detergents (e.g., DDM) .

  3. Purification: Nickel-affinity chromatography .

  4. Reconstitution: Stabilized in lipid nanodiscs or amphipols for functional studies .

Conformational Dynamics

  • Cryo-EM structures reveal MsbA adopts IFnarrow and IFwide conformations depending on the lipid environment .

  • Nanodisc-embedded MsbA shows higher ATPase activity than detergent-solubilized forms .

Mutational Analysis

MutationEffect on Lipid BindingATPase ActivitySource
R78ADisrupts phosphate interactionsAbolished stimulation
K299AWeakens glucosamine recognitionReduced by 50%
R238AEliminates exterior lipid interactionsNo lipid dependency

Applications and Implications

  • Antibiotic Development: MsbA’s essential role in LPS transport makes it a target for disrupting bacterial membrane integrity .

  • Structural Biology: Serves as a model for studying ABC transporter mechanisms .

  • Biotechnological Use: Recombinant MsbA aids in membrane protein reconstitution studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery details.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Avoid repeated freezing and thawing cycles. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag if feasible.
Synonyms
msbA; Sde_0387; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Target Names
msbA
Target Protein Sequence
MSTPAKPTSVESYKRLLSYAFKYKAYFIISFIGFGVFAAMEAQLINILEYFVDRLEGRPS APVLGLSADVTSSLWFVPISVVVLSIIRGIGAYFGNFYMSLVGLNVITNLRRQIFSQMIY LPQSFYDTKNSGELISLLVYNIEQVTGSVTNAVKTLFRDGMSVAWFLAMMLIINWKLTLA FICVAPVLGGLMYIASKYFRKVSHKIQSAVGRVSHVATESIQGIKLVKSYGGEKYELDRF NDATNQNLHYGTKFERVSAFQTPVLHIVLALALAVTFYLIMILWDSDSSKAVVYATYAAA IAKPFRQLTKINSIIQKGLAAADTIFEVLDLQAEPNSGQQKLNAPKGRVELKDVHFGYNQ DTPALNGISFAIEPGQTVALVGSSGSGKSTIVSLLLRFYDNQQGSITIDGTPIQSLELHN LREHIALVNQQTILFNDTIAANIAYGSEHIDEARIQDAAKQANAHDFIMALPNGYQTPAG EDGSRLSGGQRQRIAIARALYKNAPILILDEATSALDNESEKQIQSALDELKQGRTTLVI AHRLSTIENADTILVMDNGRIVEAGNHQTLLDRSGVYANLYHSQFS
Uniprot No.

Target Background

Function
This protein plays a critical role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) create a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation during this process.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Saccharophagus degradans Lipid A export ATP-binding/permease protein MsbA?

Saccharophagus degradans MsbA is an ATP-binding cassette (ABC) transporter protein that functions in the export of lipopolysaccharide (LPS) components to the outer membrane. Specifically, it mediates the transport of the lipid A core moiety, which serves as the hydrophobic anchor of LPS in gram-negative bacteria. The full-length protein consists of 586 amino acids and belongs to a family of transporters essential for bacterial cell viability . Unlike many characterized MsbA proteins from pathogenic bacteria such as E. coli and Salmonella, the Saccharophagus degradans variant offers insights into LPS transport mechanisms in a marine bacterium known for complex polysaccharide degradation.

What is the structural composition and functional domains of MsbA protein?

The MsbA protein contains distinct structural domains that enable its transport function:

  • Transmembrane domains (TMDs): Form a cavity that accommodates LPS during transport

  • Nucleotide-binding domains (NBDs): Responsible for ATP binding and hydrolysis

  • Connecting regions: Enable conformational changes during the transport cycle

The protein adopts various conformational states including inward-facing (nucleotide-free or ADP-bound) and outward-facing (ATP-bound) arrangements. The complete amino acid sequence of Saccharophagus degradans MsbA shows characteristic motifs of ABC transporters, including the Walker A and Walker B motifs in the NBDs . The transmembrane helices form a palm-shaped structure that cradles the lipid A molecule during transport, with specific residues interacting with the phosphorylated glucosamine backbone of lipid A .

How can recombinant MsbA protein be optimally stored and reconstituted?

For optimal storage and reconstitution of recombinant MsbA protein:

Storage ParameterRecommended Condition
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution mediumDeionized sterile water
Recommended concentration0.1-1.0 mg/mL
Glycerol recommendation5-50% (final concentration)

It is advisable to centrifuge the vial briefly before opening to bring contents to the bottom. Repeated freeze-thaw cycles should be avoided to maintain protein integrity. For functional studies, reconstituted protein should be used promptly or appropriately aliquoted with glycerol as a cryoprotectant .

What is the "trap-and-flip" model for MsbA-mediated LPS transport?

The "trap-and-flip" model for MsbA-mediated LPS transport represents a six-step process that explains how the protein facilitates LPS translocation across the membrane:

  • Step 1 (Nucleotide-free state): MsbA adopts an inward-facing conformation with TMDs opened to allow LPS entry from the inner leaflet of the membrane.

  • Step 2 (ADP or nucleotide-free state): Stably bound LPS restricts TMD opening and aligns NBDs for ATP binding.

  • Step 3 (ATP state): Conformational changes in MsbA abolish high-affinity LPS binding.

  • Step 4 (ATP state): These changes facilitate the acyl chains of LPS to enter the periplasmic leaflet.

  • Step 5 (ATP transition state): All transmembrane helices form a compact bundle after LPS release.

  • Step 6 (Return to initial state): Upon γ-phosphate release, MsbA returns to the inward-facing conformation.

This model differs from the "credit card model" proposed for P4-ATPase flippases and TMEM16 scramblase, in which the hydrophobic acyl chains remain in the membrane during flipping. The trap-and-flip mechanism involves concerted protein rearrangement and substrate translocation, leading to ATP hydrolysis .

How do MsbA-drug interactions compare with MsbA-lipid A interactions?

MsbA exhibits dual functionality as both a lipid transporter and a multidrug transporter. Comparative analysis of MsbA-drug and MsbA-lipid A interactions reveals:

ParameterDrug InteractionsLipid A Interactions
Binding modeMultiple drugs can bind at similar sitesSpecific lipid A binding site between TMDs
Inhibition kineticsCompetitive inhibition between different drugsNoncompetitive inhibition of drug transport by lipid A
Binding affinityK₁ values for vinblastine: 16 μM (ethidium) and 11 μM (Hoechst 33342)K₁ value for free lipid A: 57 μM
Functional outcomeTransported substrates or competitive inhibitorsPhysiological substrate transported via "trap-and-flip" mechanism
Structural evidenceDrug binding sites not fully resolvedClear electron density for lipid A in structural studies

These findings demonstrate that MsbA can interact with both lipid A and multiple drugs, with vinblastine and lipid A having inhibitory constants in a similar micromolar range. The noncompetitive inhibition of Hoechst 33342 transport by free lipid A suggests distinct but interconnected binding sites for drugs and lipid A .

What experimental approaches reveal MsbA conformational changes during transport?

Multiple experimental approaches have been employed to elucidate the conformational changes of MsbA during transport:

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural information of MsbA in different conformational states, revealing the positioning of LPS within the transmembrane cavity and the arrangement of TMDs and NBDs.

  • X-ray crystallography: Initially provided structural insights into different conformational states, though some early structures were later retracted.

  • Vanadate trapping: Uses vanadate to trap MsbA in the post-hydrolysis state, mimicking the ATP transition state (step 5 in the "trap-and-flip" model).

  • Nucleotide analogs: Non-hydrolyzable ATP analogs like AMPPNP have been used to capture the ATP-bound conformation (step 4).

  • Comparative modeling: Structures from homologous transporters like TM287/288 and McjD have been used as templates for model building when direct structural data was limited .

These approaches collectively demonstrate that MsbA undergoes substantial conformational changes during the transport cycle, transitioning from inward-facing to outward-facing states coupled with ATP binding and hydrolysis.

How can heterologous expression systems be optimized for functional studies of MsbA?

Optimizing heterologous expression systems for MsbA functional studies requires consideration of several factors:

Expression SystemAdvantagesConsiderationsOptimization Strategies
E. coliNative environment for many MsbA homologsEndogenous LPS may complicate drug transport studiesUse specialized strains with controlled LPS production
Lactococcus lactisLPS-deficient environment enables clearer drug transport studiesMay lack factors needed for native LPS interactionsDemonstrated 86-fold increase in erythromycin resistance when expressing MsbA
Insect cell systemsBetter membrane protein foldingHigher costOptimize expression temperature and induction conditions
Cell-free systemsAvoids toxicity issuesRequires lipid supplementationInclude specific lipids for functional reconstitution

For Saccharophagus degradans MsbA specifically, expression in E. coli has been successful, with the recombinant protein containing an N-terminal His-tag to facilitate purification . The functional expression of MsbA in L. lactis demonstrates that the protein can interact with both drugs and free lipid A in the absence of auxiliary E. coli proteins, validating this approach for mechanistic studies .

What methods can be used to measure MsbA-mediated transport activity?

Several complementary methods can be employed to measure MsbA-mediated transport activity:

  • Fluorescent substrate transport assays: Utilize fluorescent compounds like ethidium and Hoechst 33342 that are MsbA substrates. Transport can be measured by changes in fluorescence intensity as these compounds enter/exit cells or membrane vesicles.

  • Drug resistance assays: Expression of functional MsbA confers resistance to certain antibiotics (e.g., erythromycin), providing a phenotypic readout of transport activity. The 86-fold increase in erythromycin resistance observed in L. lactis expressing MsbA exemplifies this approach .

  • ATPase activity measurements: Coupling of ATP hydrolysis to transport can be measured using colorimetric assays for inorganic phosphate release or radioactive ATP.

  • Competition assays: The ability of test compounds to compete with known substrates can be assessed by measuring inhibition constants (Ki), as demonstrated for vinblastine inhibition of ethidium and Hoechst 33342 transport .

  • Lipid A transport assays: Specialized assays using radiolabeled or fluorescently tagged lipid A can directly measure the physiological transport function.

These methods allow for comprehensive characterization of MsbA transport kinetics, substrate specificity, and inhibitor interactions.

How should structural data for MsbA from different sources be reconciled?

Reconciling structural data for MsbA from different sources requires careful consideration of several factors:

  • Resolution differences: Early crystal structures of MsbA were obtained at relatively low resolutions (>5 Å), whereas more recent cryo-EM structures achieve higher resolution with better side-chain definition. Higher resolution structures generally provide more reliable atomic models.

  • Conformational states: Different techniques may capture distinct conformational states in the transport cycle. The nucleotide state (nucleotide-free, ADP-bound, ATP-bound, or vanadate-trapped) significantly influences the observed conformation.

  • Species differences: MsbA structures from different bacterial species (E. coli, Salmonella, Saccharophagus degradans) may exhibit subtle structural variations reflecting evolutionary adaptations to specific lipid A structures.

  • Model building methodology: The choice of homology modeling templates, refinement protocols, and validation methods influences the final structural model. For example, structures of TM287/288 (PDB ID: 3QF4) and McjD (PDB ID: 4PL0) have been used as templates for MsbA model building .

  • Presence of substrate: Substrate-bound structures provide insights into binding interactions but may also influence the observed conformation. The palm-shaped density between TMDs in some structures corresponds to bound LPS .

What are the implications of MsbA structural data for understanding other ABC transporters?

MsbA structural studies have several important implications for understanding the broader family of ABC transporters:

  • Conformational coupling mechanism: The MsbA "trap-and-flip" model provides a framework for understanding how conformational changes in TMDs are coupled to ATP binding and hydrolysis in NBDs across ABC transporters.

  • Substrate recognition diversity: The ability of MsbA to accommodate both lipid A and various drugs suggests that other ABC transporters may similarly recognize diverse substrates through flexible binding pockets.

  • Transporter classification: MsbA studies highlight distinctions between different transporter mechanisms. For example, the MsbA mechanism differs from that proposed for PglK, where only outward-facing conformations are relevant for substrate transport .

  • Drug resistance insights: The detailed understanding of how MsbA interacts with drugs provides insights into mechanisms of multidrug resistance mediated by other ABC transporters such as P-glycoprotein.

  • Therapeutic targeting: Structural information about MsbA can guide the development of inhibitors targeting similar ABC transporters involved in antibiotic resistance or cancer drug resistance.

The methodological approaches used to study MsbA, particularly the combination of cryo-EM with biochemical assays, establish a template for investigating other challenging membrane transport proteins .

What are promising approaches for developing MsbA inhibitors as potential antimicrobials?

Development of MsbA inhibitors as potential antimicrobials could follow several strategic approaches:

  • Structure-based drug design: Utilizing the high-resolution structural data of MsbA in complex with LPS to design molecules that competitively inhibit lipid A binding.

  • ATP-binding site targeting: Developing compounds that interfere with ATP binding or hydrolysis, potentially by mimicking the transition state.

  • Allosteric inhibitors: Identifying compounds that bind at interfaces between domains to prevent conformational changes necessary for transport.

  • Dual-target inhibitors: Creating molecules that simultaneously inhibit MsbA and other enzymes in the lipid A biosynthetic pathway.

  • Species-selective inhibitors: Exploiting structural differences between MsbA variants from different bacterial species to develop narrow-spectrum antimicrobials.

The functional expression of MsbA in L. lactis provides a valuable system for screening potential inhibitors, as demonstrated by the quantitative measurement of inhibition constants for compounds like vinblastine . The observation that free lipid A noncompetitively inhibits drug transport suggests that lipid A analogs might be developed as inhibitors that do not need to compete directly with the physiological substrate .

How can advanced structural methods further elucidate the complete LPS transport mechanism?

Advanced structural methods could address several outstanding questions about LPS transport:

  • Time-resolved cryo-EM: Capturing structural snapshots at millisecond time scales could reveal short-lived intermediate states in the transport cycle.

  • Single-molecule FRET: Probing distance changes between specific domains during transport could provide insights into conformational dynamics not accessible through static structures.

  • Hydrogen-deuterium exchange mass spectrometry: Identifying regions of MsbA that change in solvent accessibility during the transport cycle could map conformational changes with high precision.

  • Molecular dynamics simulations: Using the available structural data as starting points, simulations could model the complete pathway of LPS movement through the transporter and the energetics of this process.

  • Cross-linking coupled with mass spectrometry: Identifying residues that come into proximity during different states of the transport cycle could validate and refine the proposed mechanism.

Current structural studies have resolved portions of the LPS molecule, but the complete pathway from recognition to release remains to be fully elucidated. The strongest parts of the LPS density in current structures correspond to the two glucosamines carrying phosphate groups (1-PO₄ and 4′-PO₄) and the inner core, while the outer core is less well-defined . Advanced methods could help visualize the complete LPS molecule throughout the transport process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.