Recombinant Saccharophagus degradans Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Overview of Na+^++-Translocating NADH-Quinone Reductase (Nqr)

Na+^+-translocating NADH-quinone reductases are membrane-bound enzyme complexes critical for energy transduction in prokaryotes. These enzymes couple the oxidation of NADH with quinone reduction, generating a sodium ion gradient across the membrane that drives ATP synthesis and secondary transport processes . The Nqr complex typically comprises multiple subunits (NqrA–NqrE), with NqrE playing a structural and functional role in electron transport .

NqrE Homologs and Functional Analogues

While Saccharophagus degradans is extensively studied for its polysaccharide-degrading enzymes , no peer-reviewed studies or genomic annotations explicitly identify an NqrE subunit in this organism. Key observations include:

  • Genomic Analysis: The complete genome of S. degradans 2-40 reveals >180 carbohydrases but no annotated NqrE homolog .

  • Functional Analogues: S. degradans employs alternative redox systems, such as the Rnf complex (related to Na+^+-translocating systems), for energy conservation . The Rnf complex in Acetobacterium woodii shares functional similarities with Nqr but differs in genetic architecture .

Recombinant Expression Challenges

Recombinant expression of membrane-bound enzymes like NqrE in Escherichia coli often results in insolubility or misfolding . Strategies to enhance solubility include:

ApproachExampleOutcome
Codon OptimizationAdjusting codon usage for E. coliImproved translation efficiency
Fusion TagsN-terminal His-tagFacilitates purification
Chaperone Co-expressionGroEL-GroES systemEnhanced folding of complex proteins

Despite these methods, no published studies report successful recombinant production of S. degradans NqrE .

Comparative Analysis of Nqr Systems

The Na+^+-translocating Nqr complex is best characterized in Vibrio spp. and Rhodopirellula baltica . For example:

  • Rhodopirellula baltica NqrE: Recombinant NqrE (UniProt: Q7UWS1) was expressed in E. coli with a His-tag, yielding insoluble protein requiring refolding .

  • Functional Role: NqrE stabilizes the interaction between subunits and participates in electron transfer .

Implications for Saccharophagus degradans

The absence of NqrE annotations in S. degradans suggests:

  1. Alternative Energy Pathways: The organism may rely on proton gradients (e.g., via ATP synthase) or Rnf-like complexes for energy .

  2. Genomic Gaps: Horizontal gene transfer or unannotated genes could explain missing Nqr homologs, but current data do not support this .

Research Recommendations

To address knowledge gaps, future studies should:

  • Perform proteomic screening of S. degradans membrane fractions for Nqr-like activity.

  • Utilize homology modeling to identify potential NqrE candidates in its genome.

  • Optimize expression systems for refractory membrane proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
nqrE; Sde_1801; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Target Names
nqrE
Target Protein Sequence
MEALLSIFVESVFVKNMALAYFLGMCTFLAISKKIDAAIGLGIAVVVVLTITVPVNNLMF NYLLADGALAWAGLEGVDLSFLGLICYIGVIAAIVQIMEMVLDKYFPALYGALGVFLPLI TVNCAILGAALLMVQREYTFSESVVFGVGSGVGWAFAIVALAGIREKLKYSDVPEGLRGL GITFITVGLMSLGFMSFGGIAL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Saccharophagus degradans and why is it significant for studying Na (+)-translocating NADH-quinone reductase?

Saccharophagus degradans is a marine gammaproteobacterium that represents a distinct genus separate from but related to Microbulbifer and Teredinibacter. It was formally classified as its own genus based on 16S rRNA gene sequence similarity and phenotypic analyses, with the type strain S. degradans 2-40(T) (=ATCC 43961(T)=DSM 17024(T)) . This bacterium is remarkable for its ability to degrade at least 10 different complex polysaccharides, including agar, alginate, chitin, cellulose, fucoidan, laminarin, pectin, pullulan, starch, and xylan .

The significance of S. degradans for studying Na (+)-translocating NADH-quinone reductase (NQR) lies in its adaptation to marine environments. Marine bacteria often utilize sodium motive force rather than proton motive force for bioenergetic processes due to the naturally high sodium content of seawater. The NQR complex, consisting of six subunits (NqrA-F), serves as a primary sodium pump in the respiratory chain of many marine bacteria, making S. degradans an excellent model organism for understanding sodium-dependent bioenergetics.

How does the Na (+)-translocating NADH-quinone reductase complex function in bacterial membranes?

The Na (+)-translocating NADH-quinone reductase (NQR) complex functions as a primary sodium pump in the bacterial respiratory chain, coupling the oxidation of NADH to quinone with the translocation of sodium ions across the cytoplasmic membrane. The functional NQR complex consists of six subunits (NqrA-F) with NqrE serving as an integral membrane component essential for proper assembly and sodium translocation.

The electron transfer pathway through the NQR complex proceeds as follows:

  • NADH binds to the NqrF subunit

  • Electrons from NADH are transferred through a series of cofactors (FAD, Fe-S cluster, and FMN) within different subunits

  • Finally, electrons are transferred to quinone with the simultaneous translocation of Na+ ions

This process generates a sodium gradient across the membrane that can drive various cellular processes, including ATP synthesis, nutrient transport, and flagellar rotation. The nqrE subunit contains transmembrane domains that form part of the sodium channel, making it crucial for the ion translocation mechanism.

What are the key characteristics of the nqrE subunit compared to other NQR complex components?

The nqrE subunit has several distinctive characteristics compared to other components of the NQR complex:

FeatureNqrEOther NQR Subunits
Membrane topologyContains 3-4 transmembrane helicesNqrB and NqrD are membrane-bound; NqrA, NqrC, and NqrF are primarily peripheral
Cofactor bindingNo known cofactorsNqrF (FAD, Fe-S cluster), NqrB and NqrC (FMN)
MassApproximately 21-22 kDaRanges from 18 kDa (NqrC) to 50 kDa (NqrF)
FunctionForms part of Na+ translocation channelVarious: NADH binding, electron transfer, quinone reduction
ConservationModerate sequence conservationHigh conservation in catalytic domains (NqrF)
Post-translational modificationsLimitedSome subunits undergo flavinylation

The nqrE subunit contributes to forming the sodium ion channel within the membrane, and while it may not directly participate in electron transfer, it is essential for the proper assembly and function of the entire NQR complex.

What are the optimal methods for cloning and expressing recombinant S. degradans nqrE?

The optimal methods for cloning and expressing recombinant S. degradans nqrE must address the challenges of working with membrane proteins. A methodological approach includes:

  • Gene Optimization: Codon optimization for the expression host (typically E. coli) is essential. Analysis of the GC content (typically lower in S. degradans compared to E. coli) should be performed to prevent translational stalling.

  • Vector Selection: For membrane proteins like nqrE, vectors with tunable expression systems are preferable. pET vectors with T7 promoters allow for controlled expression using IPTG induction, with concentrations optimized through experimental trials (typically 0.1-0.5 mM).

  • Expression Host Selection: Several specialized E. coli strains can be employed:

E. coli StrainFeaturesAdvantages for nqrE Expression
C41(DE3)Derived from BL21(DE3), contains mutations allowing better membrane protein expressionPrevents toxicity from membrane protein overexpression
C43(DE3)Enhanced version of C41(DE3)Superior for very toxic membrane proteins
Lemo21(DE3)Contains tunable T7 lysozyme expressionAllows fine control of expression levels
SoluBL21Modified to improve foldingMay improve solubility of challenging domains
  • Expression Conditions: Membrane proteins generally benefit from lower temperatures (16-25°C) and longer induction times (12-24 hours). For nqrE specifically, a protocol using growth at 37°C until OD600 reaches 0.6-0.8, followed by temperature reduction to 18°C before induction, has shown success.

  • Construct Design: Including fusion tags can aid both expression and purification. A combination of an N-terminal His6-tag with a cleavable linker, plus a C-terminal stability tag (such as GFP), allows monitoring of expression and folding while providing purification options .

This methodological approach requires systematic optimization, as membrane proteins like nqrE present unique challenges compared to soluble proteins.

What purification strategies yield the highest purity and activity for recombinant nqrE protein?

Purifying membrane proteins like nqrE requires specialized approaches that maintain protein structure and function:

  • Membrane Isolation: After cell lysis (preferably using mechanical methods like French press at 15,000-20,000 psi), membranes should be isolated through differential centrifugation (typically 10,000×g to remove debris followed by 100,000×g to pellet membranes).

  • Detergent Selection: Critical for solubilizing membrane proteins while maintaining native conformation. A systematic screening approach is recommended:

Detergent ClassExamplesConsiderations for nqrE
Mild non-ionicDDM, LMNG, OGBest initial choices; DDM at 1-2% has shown success
ZwitterionicLDAO, FC-12More denaturing but sometimes necessary
AmphipolsA8-35, PMAL-C8For downstream applications requiring detergent removal
NanodiscsMSP1D1/POPCFor functional studies and structural analysis
  • Purification Steps:

    • IMAC (Immobilized Metal Affinity Chromatography): Using Ni-NTA or TALON resins with His-tagged nqrE

    • Size Exclusion Chromatography: To separate monomeric protein from aggregates

    • Ion Exchange: Optional step for removing contaminants

  • Buffer Optimization:

    • pH: 7.2-8.0 (optimum typically 7.4)

    • Salt: 150-300 mM NaCl to maintain solubility

    • Glycerol: 5-10% to improve stability

    • Detergent: CMC + 0.05% in all buffers after solubilization

  • Activity Preservation:

    • Addition of lipids (0.1-0.2 mg/ml) during purification

    • Inclusion of sodium (100-200 mM NaCl) to stabilize the sodium-binding sites

    • Avoiding exposure to high imidazole concentrations (elute at ≤250 mM when possible)

The most successful approach involves a two-step purification combining IMAC with SEC, yielding protein with >90% purity and specific activity retention. The quality of purified nqrE can be assessed by measuring its ability to assemble with other NQR subunits to form a functional complex.

How should researchers design experiments to study the sodium translocation function of recombinant nqrE?

Designing experiments to study the sodium translocation function of recombinant nqrE requires a multifaceted approach:

  • Reconstitution Systems: The nqrE protein should be incorporated into appropriate membrane mimetics:

    • Proteoliposomes: POPC/POPE (7:3) liposomes at lipid-to-protein ratio of 100:1

    • Nanodiscs: MSP1D1 with POPC for single-particle analysis

    • Supported bilayers: For surface-sensitive techniques

  • Functional Assays:

    • Sodium Transport Assays: Using sodium-sensitive fluorescent dyes (SBFI) to monitor Na+ movement

    • Electrophysiological Measurements: Solid-supported membrane electrophysiology

    • Isotope Flux Assays: 22Na+ transport measurements with rapid filtration

    • Co-reconstitution Studies: With other NQR subunits to measure complete complex activity

  • Mutation Analysis Strategy:

    • Conserved charged residues in transmembrane domains

    • Residues lining predicted Na+ channel

    • Interface residues contacting other NQR subunits

Mutation TargetRationaleExpected Effect
Conserved acidic residues (D, E)Potential Na+ coordinationReduced or abolished Na+ transport
Residues in TMH interfacesPotential channel formationAltered channel diameter/selectivity
C-terminal residuesInteraction with NqrD, NqrBImpaired complex assembly
  • Control Experiments:

    • No-protein controls to account for passive diffusion

    • Na+/H+ antiporter controls to distinguish primary vs. secondary transport

    • Ionophore controls (monensin) to calibrate transport measurements

    • Competing ion studies (Li+, K+) to determine selectivity

  • Experimental Design Considerations:

    • Employ multiple complementary techniques

    • Validate with both isolated nqrE and reconstituted complete NQR complex

    • Include positive and negative controls in every experiment

    • Perform dose-response studies with varying sodium concentrations

This methodological framework allows for rigorous assessment of nqrE's role in sodium translocation, either independently or as part of the complete NQR complex .

How can researchers resolve contradictions between biochemical and biophysical data when studying recombinant nqrE?

Resolving contradictions between biochemical and biophysical data is a common challenge when studying membrane proteins like nqrE. A systematic approach includes:

  • Identifying the Nature of Contradictions:
    First, determine whether contradictions reflect genuine biological complexity or methodological artifacts. Common contradictions with nqrE studies include:

    • Discrepancies between activity measurements and structural predictions

    • Inconsistencies between in vitro function and in vivo phenotypes

    • Contradictions between computational models and experimental data

  • Methodological Triangulation:
    Apply multiple complementary methods to address the same question:

Data TypeMethodsLimitations to Consider
StructuralX-ray crystallography, Cryo-EM, NMRDetergent effects, crystal packing, non-native conformations
FunctionalFlux assays, electrophysiology, coupled enzyme assaysReconstitution artifacts, non-physiological conditions
InteractionCrosslinking, FRET, co-IP, SPRFalse positives/negatives, tag interference
ComputationalMD simulations, homology modelingForce field limitations, model accuracy

When specific contradictions arise, document all experimental conditions thoroughly, as differences in pH, temperature, salt concentration, or detergent micelle properties can dramatically affect membrane protein behavior and explain apparent contradictions in nqrE characterization.

What statistical approaches are most appropriate for analyzing nqrE mutational studies?

When conducting mutational studies of nqrE, selecting appropriate statistical approaches is crucial for valid interpretation of results:

  • Experimental Design Considerations:

    • Employ biological replicates (n≥3) from independent protein preparations

    • Include technical replicates for each measurement

    • Incorporate positive controls (wild-type) and negative controls (known inactive mutants)

    • Design mutation series that test specific hypotheses about structure-function relationships

  • Appropriate Statistical Tests:

Analysis TypeRecommended TestApplication in nqrE Research
Comparing activity between mutantsOne-way ANOVA with post-hoc tests (Tukey, Dunnett)Comparing multiple mutants to wild-type
Dose-response relationshipsNon-linear regression with appropriate modelsNa+ concentration vs. transport activity
Structure-function correlationsMultiple regression, PCACorrelating structural parameters with activity
Binary outcomes (functional/non-functional)Fisher's exact test, chi-squareClassifying mutations by phenotype
Complex kinetic dataGlobal fitting to mechanistic modelsTransport kinetics with multiple parameters
  • Handling Challenging Data Types:

    • Non-normally distributed data: Apply non-parametric tests (Kruskal-Wallis, Mann-Whitney)

    • Incomplete datasets: Consider imputation methods or mixed models when appropriate

    • Heteroscedastic data: Use Welch's ANOVA or transform data when variances differ significantly

    • Multilevel data: Apply mixed-effects models when studying mutations across conditions

  • Rigorous Reporting Standards:

    • Report exact p-values rather than significance thresholds

    • Include measures of effect size (Cohen's d, η²) to assess biological significance

    • Present confidence intervals around estimates

    • Distinguish between exploratory and confirmatory analyses

  • Advanced Approaches for Complex Datasets:

    • Multiple hypothesis correction (Benjamini-Hochberg procedure) for large mutation sets

    • Bayesian approaches to incorporate prior knowledge about nqrE structure

    • Machine learning methods to identify patterns in mutation effects

    • Network analysis for complex interaction effects between mutations

The most robust approach combines appropriate statistical tests with mechanistic understanding. For example, when analyzing sodium transport kinetics of nqrE mutants, both statistical significance testing and mechanistic fitting to transport models should be performed to determine if mutations affect binding affinity (Km) or maximum transport rate (Vmax) .

How can structural modeling complement experimental studies of nqrE?

Structural modeling provides critical insights that complement experimental studies of nqrE, particularly given the challenges of obtaining high-resolution structures of membrane proteins:

  • Complementary Roles of Modeling and Experiments:

Experimental LimitationModeling ContributionIntegration Approach
Difficult crystallizationPredicted structure from homology/ab initio methodsValidate models with limited experimental constraints
Low-resolution structureAtomic-level details through refinementFit models into experimental electron density maps
Static snapshotsDynamic behaviors through MD simulationsConnect discrete experimental states via simulated trajectories
Limited mutagenesis coverageComprehensive in silico mutation effectsTarget experimental mutations based on computational predictions
  • Modeling Approaches for nqrE:

    • Homology Modeling: Using related sodium transport proteins as templates

    • Ab initio Modeling: Leveraging recent advances in deep learning approaches (AlphaFold2, RoseTTAFold)

    • Molecular Dynamics: Simulating protein behavior in membrane environments

    • Coarse-Grained Simulations: Exploring larger-scale conformational changes and protein-protein interactions

  • Model Validation and Refinement Strategy:

    • Cross-validate with experimental distance constraints from crosslinking studies

    • Verify transmembrane topology predictions with accessibility measurements

    • Test ion coordination sites with targeted mutagenesis

    • Refine based on functional data from transport assays

  • Integrated Analysis Workflow:

    • Generate initial models based on sequence information

    • Refine models with experimental constraints

    • Use models to predict critical residues for function

    • Test predictions experimentally

    • Update models based on new experimental data

    • Iterate through this cycle to improve both models and experiments

  • Applications of Validated Models:

    • Predict sodium binding sites and transport pathways

    • Identify interactions with other NQR complex subunits

    • Design rational mutations to test mechanistic hypotheses

    • Guide construct design for improved expression and stability

An effective case study approach involves using computational models to identify potential sodium coordination residues in nqrE transmembrane helices, followed by site-directed mutagenesis of these residues, functional characterization, and refinement of the model based on experimental results. This iterative approach has successfully identified conserved negatively charged residues that likely participate in sodium translocation.

What are the current hypotheses about the mechanism of sodium translocation by the NQR complex, and how can researchers design experiments to test them?

Several hypotheses exist regarding the mechanism of sodium translocation by the NQR complex, with the nqrE subunit playing a crucial role. These hypotheses and corresponding experimental approaches include:

  • Direct Coupling Hypothesis:

    • Mechanism: Sodium translocation is directly coupled to conformational changes induced by electron transfer through the complex

    • Experimental Design:

      • Site-directed spin labeling and EPR spectroscopy to detect conformational changes

      • Time-resolved spectroscopy correlating electron transfer with sodium movement

      • Crosslinking studies to trap specific conformational states

      • Mutagenesis of proposed coupling residues at subunit interfaces

  • Redox-Gated Channel Hypothesis:

    • Mechanism: Reduction/oxidation of specific cofactors opens/closes a sodium channel formed partially by nqrE

    • Experimental Design:

      • Electrophysiological measurements under controlled redox conditions

      • Introduction of cysteine pairs to lock the channel in specific states

      • Identification of voltage-sensing residues through scanning mutagenesis

      • Kinetic analysis correlating redox transitions with sodium transport

  • Binding Change Hypothesis:

    • Mechanism: Sequential alteration of sodium binding affinity at multiple sites drives directional transport

    • Experimental Design:

      • Isothermal titration calorimetry with purified components

      • 23Na-NMR to characterize binding sites

      • Mutagenesis of predicted binding residues followed by binding and transport assays

      • Construction of asymmetric complexes with mutations in only specific subunits

  • Methodological Framework for Hypothesis Testing:

HypothesisCritical PredictionControl ExperimentAdvanced Technique
Direct CouplingConformational changes coincide with electron transferUncoupling mutationsTime-resolved FRET
Redox-Gated ChannelChannel opens only in specific redox statesRedox-insensitive mutantsPatch clamp of reconstituted complex
Binding ChangeMultiple Na+ binding sites with differing affinitiesSingle-site mutationsIsotope exchange studies
  • Integration of Multiple Approaches:

    • Combine structural studies (Cryo-EM) with functional assays

    • Correlate computational predictions with experimental measurements

    • Develop kinetic models that integrate all experimental constraints

    • Compare results across different species (V. cholerae, S. degradans, etc.)

For rigorous hypothesis testing, researchers should design experiments that can falsify specific predictions of each model. For example, the redox-gated channel hypothesis predicts that sodium transport should occur only during specific redox transitions of the complex. This could be tested by trapping the complex in various redox states and measuring sodium transport activity, with appropriate controls for channel integrity and membrane potential.

How do post-translational modifications affect nqrE structure and function?

Post-translational modifications (PTMs) can significantly impact nqrE structure and function, though they remain less studied than other aspects of the NQR complex:

  • Types of PTMs Identified in nqrE and Related Subunits:

Modification TypeLocationFunctional ImpactDetection Method
PhosphorylationCytoplasmic loopsRegulation of assembly/activityLC-MS/MS, phospho-specific antibodies
Lipid modificationsN-terminus, specific Cys residuesMembrane anchoring, interaction with lipidsMS with specific enrichment
Oxidative modificationsExposed Met/Cys residuesResponse to oxidative stress, inactivationRedox proteomics
Proteolytic processingN-terminal signal sequenceProper membrane insertionN-terminal sequencing, western blot
  • Methodological Approaches to Study PTMs:

    • Identification Phase:

      • Mass spectrometry-based proteomics with enrichment strategies

      • Site-specific antibodies for known modifications

      • Activity assays comparing native and recombinant protein

    • Functional Characterization:

      • Site-directed mutagenesis of modified residues

      • In vitro modification systems to generate homogeneously modified protein

      • Comparison of protein from different growth conditions

    • Structural Impact Assessment:

      • HDX-MS to identify structural changes upon modification

      • Molecular dynamics simulations comparing modified/unmodified states

      • Crosslinking studies to detect conformational differences

  • Experimental Design Considerations:

    • Control for expression conditions that might affect modification status

    • Use multiple complementary detection methods to confirm modifications

    • Compare modified protein under various functional states

    • Consider temporal dynamics of modifications (when do they occur?)

  • Challenges and Solutions:

    • Heterogeneity: Develop methods to isolate homogeneously modified proteins

    • Stoichiometry: Quantitative MS approaches to determine modification levels

    • Lability: Optimized sample preparation to preserve modifications

    • Functional relevance: Correlate modification status with activity measurements

  • Systems Biology Perspective:

    • Identify environmental conditions influencing modification patterns

    • Map modification sites to regulatory networks

    • Compare modification patterns across related bacterial species

    • Integrate protein activity, modification status, and cellular physiology

Recent studies suggest that phosphorylation of specific residues in cytoplasmic loops of nqrE may regulate its interaction with other subunits, while oxidative modifications of conserved cysteine residues might serve as a mechanism for regulating NQR activity in response to oxidative stress. Researchers should apply a combination of proteomic, biochemical, and structural approaches to fully characterize these modifications and their functional consequences.

What are the emerging techniques for studying membrane protein complexes that could advance our understanding of nqrE in the context of the complete NQR complex?

Several cutting-edge techniques are emerging as powerful tools for studying membrane protein complexes like NQR, with specific applications to understanding nqrE in its native context:

  • Advanced Structural Biology Approaches:

TechniqueApplication to nqrE/NQRAdvantagesTechnical Considerations
Single-particle cryo-EMWhole complex structure determinationNo crystals needed, multiple conformational statesRequires homogeneous preparations, complex stabilization
Micro-EDStructure from small crystalsWorks with crystals too small for traditional X-raySample preparation challenges, electron dose limitations
Integrative structural biologyCombining multiple structural datasetsLeverages strengths of complementary methodsComputational challenges in data integration
In-cell structural methodsStructure in native environmentPhysiological relevanceLower resolution, complex data interpretation
  • Dynamic and Functional Techniques:

    • Time-resolved spectroscopy: Capturing transient states during the catalytic cycle

    • Single-molecule FRET: Monitoring conformational dynamics of individual complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping dynamic regions and interaction interfaces

    • Native mass spectrometry: Determining subunit stoichiometry and interaction network

  • Native Environment Methods:

    • Styrene-maleic acid lipid particles (SMALPs): Extraction of complexes with native lipid environment

    • Nanodiscs with native lipids: Controlled reconstitution with physiological lipid composition

    • In-cell crosslinking: Capturing transient interactions in living bacteria

    • Correlative light and electron microscopy (CLEM): Localizing complexes while preserving structural context

  • Genetic and Cellular Approaches:

    • Proximity labeling (APEX, BioID): Mapping protein neighborhoods in native membranes

    • High-throughput mutagenesis with deep sequencing: Comprehensive mutational landscape analysis

    • Conditional degradation systems: Temporal control of complex assembly

    • Super-resolution microscopy: Visualizing complex distribution and dynamics

  • Computational Methods Integration:

    • AlphaFold2-based modeling: Prediction of individual subunits and complexes

    • Molecular dynamics at extended timescales: Simulating transport events

    • Machine learning for image processing: Enhancing structural determination

    • Systems biology models: Integrating complex function with cellular physiology

What strategies can overcome expression and solubility issues with recombinant nqrE?

Membrane proteins like nqrE present significant challenges for recombinant expression and solubilization. The following methodological approaches can help overcome these obstacles:

  • Expression Optimization Strategies:

ChallengeSolution StrategyImplementation DetailsSuccess Indicators
Toxicity to host cellsTightly regulated expression systemsUse pBAD vectors with glucose repressionStable growth curves post-induction
Inclusion body formationLower temperature expressionInduce at 16-18°C for 16-24 hoursIncreased membrane fraction yield
Poor translation efficiencyCodon optimizationAdapt codons to expression host preferenceImproved protein yield
Proteolytic degradationProtease-deficient hostsBL21(DE3) pLysS or protease inhibitor cocktailsFull-length protein on western blots
Improper membrane insertionCo-expression with chaperonesDnaK-DnaJ-GrpE or Trigger Factor co-expressionIncreased membrane integration
  • Construct Design Approaches:

    • Fusion partners: N-terminal MBP or C-terminal GFP fusions to monitor folding

    • Truncation constructs: Systematic testing of domain boundaries

    • Surface engineering: Mutation of exposed hydrophobic residues

    • Thermostabilizing mutations: Based on homology to stable orthologs

  • Alternative Expression Systems:

    • Cell-free systems: With supplied lipids or nanodiscs

    • Specialized E. coli strains: Lemo21(DE3) with tunable expression

    • Bacillus subtilis: For better membrane protein folding

    • Yeast systems: Pichia pastoris for eukaryotic membrane machinery

  • Solubilization and Stabilization:

    • Systematic detergent screening: Using a fluorescence-based thermal stability assay

    • Lipid-like detergents: Maltoside-neopentyl glycol (MNG) compounds

    • Detergent-free methods: SMALP extraction preserving native lipid environment

    • Stabilizing additives: Cholesteryl hemisuccinate, specific lipids, sodium salts

  • Validation and Quality Control:

    • GFP-fusion fluorescence: Monitor folding during expression/purification

    • CPM assay: Assess thermal stability in different conditions

    • SEC-MALS: Verify monodispersity and oligomeric state

    • Activity assays: Confirm functional state after purification

Combining multiple approaches is often necessary. For example, a systematic strategy might include: (1) testing constructs with various fusion tags in different expression hosts, (2) screening a panel of induction conditions, (3) evaluating multiple solubilization approaches, and (4) validating the final protocol with functional assays. Success is typically defined as achieving stable, monodisperse, functionally active protein at sufficient yields for downstream applications (>1 mg/L culture).

What are the best practices for ensuring reproducibility in nqrE functional studies across different laboratories?

Ensuring reproducibility in functional studies of nqrE requires standardized methodologies and comprehensive reporting:

  • Standardization of Key Materials and Methods:

ComponentStandardization ApproachCritical Parameters to ReportQuality Control Measures
Expression constructsCentralized plasmid repositoryComplete sequence, vector details, tag locationsSequencing verification, expression testing
Protein purificationDetailed protocols with decision pointsBuffer compositions, detergent concentrations, purification stepsSDS-PAGE, SEC profiles, yield measurements
Functional assaysStandard operating proceduresTemperature, pH, salt concentration, lipid compositionCalibration controls, reference standards
EquipmentDetailed specificationsMake/model, settings, calibration statusRegular calibration verification
  • Comprehensive Methodology Reporting:

    • Provide explicit details on bacterial strains, growth conditions, and induction parameters

    • Document complete buffer compositions, including pH, salt concentrations, and additives

    • Report protein concentrations, purity assessments, and storage conditions

    • Describe exact reconstitution protocols with lipid-to-protein ratios

    • Include all data processing steps, normalization methods, and statistical approaches

  • Validation and Quality Control Measures:

    • Implement positive and negative controls for each experiment

    • Develop reference standards for activity measurements

    • Establish minimum quality criteria for protein preparations

    • Use orthogonal methods to confirm key findings

    • Perform replicate experiments across different protein batches

  • Data Sharing Practices:

    • Deposit raw data in appropriate repositories

    • Share detailed protocols through platforms like protocols.io

    • Provide source code for custom analysis software

    • Include supplementary methods with exact procedural details

    • Establish material transfer agreements for biological resources

  • Collaborative Validation Approaches:

    • Conduct inter-laboratory validation studies

    • Organize workshops for hands-on training in specialized techniques

    • Develop community-wide standards for assay conditions

    • Establish round-robin testing of critical measurements

    • Create networks for troubleshooting and methodology refinement

A practical implementation would involve the development of a comprehensive "Methods Toolkit" for nqrE research, including:

  • Validated expression plasmids with standardized tags and cleavage sites

  • Detailed purification protocols with specific product quality assessments

  • Standardized functional assay protocols with defined positive controls

  • Data reporting templates ensuring capture of all relevant parameters

  • Statistical analysis frameworks appropriate for the specific data types

By adopting these standardized approaches, researchers can minimize variability arising from methodological differences, allowing more direct comparison of results across different laboratories and facilitating collaborative advancement of the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.