Recombinant Saccharophagus degradans UPF0316 protein Sde_0566 (Sde_0566)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us for prioritized development.
Synonyms
Sde_0566; UPF0316 protein Sde_0566
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Target Names
Sde_0566
Target Protein Sequence
MNEWLNVAPELLALLIFVSRVIDVSLGTFRTIVIFRGYKALAAFIGFFEIMIWLVAAGQV FKNLDQWYLALAYAGGFSMGNYVGMWIENRFAIGNELVRCLSFNRDVLAEKIREQGFKVI SFDGDMGTDKLVELLFIVEKRRNVPALIKLIKELDASAVYSVSDVKSVYEGPEPLPRRLF FR
Uniprot No.

Target Background

Database Links

KEGG: sde:Sde_0566

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Saccharophagus degradans and why is Sde_0566 protein significant?

Saccharophagus degradans strain 2-40 is a marine bacterium that plays a crucial role in recycling complex polysaccharides in marine and estuarine environments. It represents an emerging group of bacteria that contribute to the marine carbon cycle through the mineralization of complex polysaccharides to carbon dioxide . The bacterium possesses an extraordinary range of catabolic capabilities, with the ability to degrade more than 10 complex polysaccharides including agar, alginate, and chitin .

Sde_0566 protein belongs to the UPF0316 protein family of S. degradans. While the specific function of this protein isn't fully characterized in the available search results, its study is part of broader research efforts to understand the unique enzymatic capabilities of this organism. The protein's significance lies in its potential role within the complex enzymatic systems that enable S. degradans to degrade plant and algal cell walls in marine environments, a process that is not well-characterized but critical to marine carbon transformation .

How does Sde_0566 compare to other proteins in the S. degradans genome?

The S. degradans genome contains an unusually large number of enzymes dedicated to the degradation of complex polysaccharides. Many of these enzymes exhibit unusual architectural features, including novel combinations of catalytic and substrate-binding modules . While the specific properties of Sde_0566 in relation to other proteins aren't detailed in the search results, comparative genomic analysis would typically involve:

  • Sequence alignment with homologous proteins in S. degradans and other organisms

  • Domain architecture analysis using bioinformatics tools

  • Phylogenetic analysis to determine evolutionary relationships

  • Functional prediction based on conserved motifs

Researchers should consider performing these analyses to place Sde_0566 in the context of the organism's broader enzymatic capabilities and to identify potential functional roles within polysaccharide degradation pathways.

What are the optimal conditions for expressing recombinant Sde_0566 protein?

The recombinant full-length Saccharophagus degradans UPF0316 protein Sde_0566 is expressed in E. coli with an N-terminal His tag . While specific optimization details aren't provided in the search results, researchers should consider the following methodological approach based on common challenges in full-length protein expression:

  • Codon optimization: Analyze the protein sequence for rare codons that might affect expression in E. coli. Consider using codon-optimized synthetic genes if numerous rare codons are present .

  • Expression vector selection: Choose vectors with appropriate promoters for controlled expression. For Sde_0566, vectors that have successfully produced the His-tagged version should be prioritized .

  • Host strain selection: Consider BL21(DE3) or Rosetta strains for proteins with rare codons.

  • Induction conditions: Optimize IPTG concentration, temperature, and induction time. Lower temperatures (16-25°C) often improve soluble protein yields.

  • Media formulation: Test rich media (LB) versus defined media (M9) depending on downstream applications.

The following table summarizes typical optimization parameters for recombinant protein expression in E. coli:

ParameterRange to TestConsiderations for Sde_0566
Temperature16-37°CLower temperatures may improve solubility
IPTG concentration0.1-1.0 mMStart with 0.5 mM and optimize
Induction time4-24 hoursLonger times at lower temperatures
OD600 at induction0.4-0.8Mid-log phase typically optimal
MediaLB, TB, M9Rich media for higher yields

What purification strategy yields the highest purity for Sde_0566 protein?

The recombinant Sde_0566 protein is fused to an N-terminal His tag, which facilitates purification using immobilized metal affinity chromatography (IMAC) . Based on information from the search results and general protein purification principles, the following methodological approach is recommended:

  • Affinity chromatography: Use Ni-NTA or TALON resin for His-tagged protein purification. Increase imidazole concentration during elution to distinguish full-length proteins from truncated products .

  • Buffer optimization: The protein is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This suggests stability at slightly alkaline pH.

  • Further purification: If higher purity is required beyond the >90% achieved through IMAC , consider size exclusion chromatography (SEC) or ion exchange chromatography as secondary purification steps.

  • Quality control: Verify purity using SDS-PAGE and confirm identity through Western blotting or mass spectrometry.

  • Storage considerations: The protein is recommended to be stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

How can researchers address challenges in obtaining soluble Sde_0566 protein?

While specific solubility challenges for Sde_0566 aren't mentioned in the search results, full-length proteins often present solubility issues during recombinant expression . Researchers can employ the following methodological approaches to improve solubility:

  • Fusion partner strategy: Consider fusion with solubility-enhancing tags such as MBP, GST, or SUMO in addition to the His tag.

  • Expression condition optimization: Lower temperature, reduced inducer concentration, and slower induction can improve solubility.

  • Co-expression with chaperones: GroEL/GroES, DnaK/DnaJ, or trigger factor co-expression can assist proper folding.

  • Additive screening: Include solubility enhancers like sorbitol, glycerol, or non-detergent sulfobetaines in the lysis buffer.

  • Membrane protein considerations: Given the amino acid sequence of Sde_0566, it may have transmembrane regions. If so, specific detergent extraction methods should be considered .

What bioinformatic approaches can predict the function of Sde_0566?

To predict the function of the relatively uncharacterized Sde_0566 protein, researchers should employ a comprehensive bioinformatic workflow:

  • Sequence homology analysis: Compare the amino acid sequence with databases using BLAST, HMMer, and profile-based methods to identify related proteins with known functions.

  • Domain and motif identification: Use tools like PFAM, PROSITE, or InterPro to identify conserved domains or functional motifs within the sequence.

  • Structural prediction: As mentioned in search result , AI-based protein structure prediction technologies like AlphaFold2 have significantly improved the ability to predict three-dimensional structures of unknown proteins. Generate a structural model of Sde_0566 and compare it with known structures.

  • Genomic context analysis: Examine the location of the gene encoding Sde_0566 within the S. degradans genome. Proximity to genes involved in polysaccharide degradation could suggest functional relationships.

  • Protein-protein interaction prediction: Use tools like STRING to predict potential interaction partners that might provide functional insights.

The methodological sequence should begin with sequence-based analyses, proceed to structural predictions, and culminate in experimental validation of the predicted functions.

How can researchers experimentally determine the substrate specificity of Sde_0566?

While the specific function of Sde_0566 is not detailed in the search results, S. degradans is known for its ability to degrade various complex polysaccharides . To determine if Sde_0566 plays a role in this process, researchers should follow this methodological approach:

  • Activity screening assays: Test the purified protein against a panel of potential substrates relevant to S. degradans metabolism, including various polysaccharides (cellulose, chitin, agar, alginate) using appropriate activity assays.

  • Binding assays: Perform substrate binding assays using isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to detect physical interactions with potential substrates.

  • Structural studies: Conduct crystallography or cryo-EM studies of Sde_0566 in complex with potential substrates or substrate analogs to identify binding sites.

  • Mutagenesis: Create targeted mutations in conserved residues predicted to be involved in substrate binding or catalysis, then assess the impact on activity.

  • In vivo validation: Create knockout or knockdown studies in S. degradans to assess the physiological role of Sde_0566 in polysaccharide degradation pathways.

What protein-protein interaction studies would be most informative for understanding Sde_0566's role?

To elucidate the functional role of Sde_0566 within the context of S. degradans' metabolic networks, the following protein-protein interaction methodologies should be considered:

  • Co-immunoprecipitation (Co-IP): Similar to the approach used in case study 2 from search result , where two-way co-immunoprecipitation was used to confirm NME-DNM2 interaction. This method could identify binding partners of Sde_0566 in native conditions.

  • Yeast two-hybrid screening: Screen a S. degradans cDNA library to identify potential interaction partners.

  • Proximity labeling: Use BioID or APEX2 fusions to identify proteins in close proximity to Sde_0566 in vivo.

  • Pull-down assays: Use the recombinant His-tagged Sde_0566 in pull-down experiments with S. degradans lysates to identify binding partners.

  • Cross-linking mass spectrometry: Apply chemical cross-linking combined with mass spectrometry to identify proteins that interact with Sde_0566 and determine the interaction interfaces.

The data from these experiments should be analyzed in the context of S. degradans' known polysaccharide degradation systems to understand how Sde_0566 might contribute to these processes.

How does Sde_0566 contribute to S. degradans' role in marine carbon cycling?

S. degradans plays a significant role in marine carbon cycling through the mineralization of complex polysaccharides to carbon dioxide . To understand Sde_0566's potential contribution to this process, researchers should consider the following methodological approaches:

  • Comparative expression analysis: Use RNA-Seq or quantitative PCR to compare the expression of Sde_0566 under different carbon source conditions (e.g., various polysaccharides vs. simple sugars).

  • Gene knockout studies: Generate a Sde_0566 deletion mutant and assess its ability to grow on different carbon sources and degrade various polysaccharides compared to the wild-type strain.

  • Environmental transcriptomics: Analyze the expression of Sde_0566 homologs in natural marine environments to understand its relevance in situ.

  • Isotopic labeling: Use 13C-labeled substrates to track carbon flow through metabolic pathways potentially involving Sde_0566.

  • Metabolic flux analysis: Compare metabolic fluxes in wild-type and Sde_0566 mutant strains to identify pathways affected by the protein.

These approaches would provide insights into whether Sde_0566 is directly involved in polysaccharide degradation or plays a supporting role in the bacterium's carbon metabolism.

What ecological implications arise from studying proteins like Sde_0566 in marine bacteria?

Studying proteins like Sde_0566 in marine bacteria such as S. degradans has several ecological implications that extend beyond basic research. Methodologically, researchers should approach this question through:

  • Metagenomic analysis: Search for Sde_0566 homologs in diverse marine environments to understand the distribution of this protein family across marine ecosystems.

  • Environmental expression studies: Use metatranscriptomics to determine if and when Sde_0566-like proteins are expressed in natural environments.

  • Biogeochemical modeling: Incorporate knowledge about S. degradans and its enzymatic capabilities into models of marine carbon cycling to predict impacts on carbon sequestration and greenhouse gas production.

  • Climate change impact assessment: Investigate how changing ocean conditions (temperature, pH, oxygen levels) affect the expression and activity of Sde_0566 and related proteins.

  • Biotechnological application assessment: Evaluate the potential for using Sde_0566 or related proteins in bioremediation of marine environments or biomass conversion applications.

The ecological significance lies in understanding how specialized bacterial enzymes like those in S. degradans influence the fate of complex polysaccharides in marine environments, which has implications for global carbon cycling and climate regulation .

What innovative approaches can be used to study membrane-associated properties of Sde_0566?

Based on the amino acid sequence provided in search result , Sde_0566 may have membrane-associated properties. To study these aspects, researchers should consider these advanced methodological approaches:

  • Nanodiscs technology: Reconstitute purified Sde_0566 into nanodiscs to study its behavior in a membrane-like environment while maintaining water solubility.

  • MNP platform application: As mentioned in search result , the MNP platform extracts high-purity nanoscale cell membrane particles while maintaining the conformation and activity of membrane proteins. This approach could be valuable for studying Sde_0566 if it has transmembrane domains.

  • Fluorescence microscopy techniques: Use techniques like FRET or FRAP to study the dynamics and interactions of fluorescently labeled Sde_0566 in artificial membrane systems or living cells.

  • Cryo-electron microscopy: Apply single-particle cryo-EM to visualize Sde_0566's structure in a membrane environment at near-atomic resolution.

  • Molecular dynamics simulations: Perform computational simulations of Sde_0566 in a membrane environment to predict its behavior and potential interaction partners.

These approaches would provide detailed insights into any membrane-associated functions of Sde_0566, which could be particularly relevant given S. degradans' role in degrading complex polysaccharides that may require membrane-associated enzymatic activities.

How can advanced protein engineering enhance the utility of Sde_0566 for research purposes?

Protein engineering can significantly enhance the research utility of proteins like Sde_0566. The following methodological approaches should be considered:

  • Structure-guided mutagenesis: Once the structure is predicted or determined, introduce specific mutations to test functional hypotheses or enhance stability.

  • Domain swapping: Create chimeric proteins by swapping domains between Sde_0566 and related proteins to understand domain functions.

  • Activity enhancement: Apply directed evolution techniques to potentially enhance the catalytic activity or substrate specificity if enzymatic functions are identified.

  • Stability engineering: Introduce mutations that enhance the thermostability or solubility of the protein to improve its handling for research purposes.

  • Tag optimization: Evaluate different affinity tags and their positions (N- or C-terminal) to optimize expression, purification, and activity of the recombinant protein.

As noted in search result , AI-based protein design is an emerging field that allows the creation of customized proteins with specific functions. These approaches could potentially be applied to Sde_0566 to create variants with enhanced properties for research applications.

What computational methods are most effective for predicting functional interactions of Sde_0566?

To predict functional interactions of relatively uncharacterized proteins like Sde_0566, researchers should employ a multi-faceted computational approach:

As noted in search result , with the accumulation of more information about protein sequences and structures, combined with advances in artificial intelligence technology, computational tools for studying full-length proteins continue to improve, making these approaches increasingly powerful for understanding proteins like Sde_0566.

How can researchers address protein stability issues when working with Sde_0566?

Protein stability is a common challenge when working with recombinant proteins. For Sde_0566, the following methodological approaches are recommended:

  • Buffer optimization: Based on information from search result , Sde_0566 is stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. Researchers should:

    • Perform buffer screening to identify optimal pH, salt concentration, and additives

    • Test the effect of different stabilizers beyond trehalose (e.g., glycerol, sucrose)

    • Evaluate the impact of reducing agents if cysteine residues are present

  • Storage protocol refinement: The recommended storage is as a lyophilized powder, with reconstitution in deionized sterile water and addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Researchers should:

    • Validate protein activity after multiple freeze-thaw cycles

    • Compare different storage methods (lyophilization vs. solution)

    • Test small aliquots to minimize freeze-thaw cycles

  • Stability assessment methods: Implement techniques to monitor protein stability:

    • Differential scanning fluorimetry (DSF) to determine thermal stability

    • Dynamic light scattering (DLS) to monitor aggregation

    • Activity assays over time to track functional stability

  • Protease inhibition: Include appropriate protease inhibitors during purification and storage to prevent degradation.

What are the best approaches for resolving expression issues with Sde_0566?

When encountering expression issues with recombinant proteins like Sde_0566, researchers should systematically explore the following methodological strategies:

  • Codon optimization analysis:

    • Analyze the native Sde_0566 sequence for rare codons in E. coli

    • Consider synthesizing a codon-optimized gene for improved expression

    • Address potential issues with translation initiation by optimizing the region around the start codon

  • Expression system refinement:

    • Test alternative E. coli strains (BL21, Rosetta, Arctic Express)

    • Consider eukaryotic expression systems if E. coli expression is problematic

    • Evaluate different promoters for optimal expression level control

  • Fusion partner exploration:

    • While Sde_0566 is described with an N-terminal His tag , other fusion partners might improve expression

    • Test solubility-enhancing tags (MBP, GST, SUMO) in addition to the His tag

    • Evaluate the impact of tag position (N-terminal vs. C-terminal)

  • Induction protocol optimization:

    • Systematically vary induction temperature (16°C, 25°C, 37°C)

    • Test different inducer concentrations

    • Explore auto-induction media as an alternative to IPTG induction

  • Truncation constructs:

    • If full-length protein expression remains challenging, design truncated constructs based on domain predictions

    • Create a series of N- and C-terminal truncations to identify stable, expressible domains

As noted in search result , expression of full-length proteins can be challenging due to factors including protein hydrophobicity, codon rarity, and protein toxicity. A systematic approach is essential to overcome these challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.