Recombinant Saccharopolyspora erythraea ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; SACE_6284; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Target Names
atpF
Target Protein Sequence
MLAAEGGHNPIIPEPVEIVVGLVAFLLLLFVLWKYAVPRFEKVYEERSKRIEGGIEKAEA AQAEAQRTLEQYRSQLAEARAEAARIRDDARAEGQQIVEEMRAQAQAESERIVSAGQSAL AAQRAQIVAELRADLGRQAVDLAGRVVGESLEDEARRRGTVDRFLDELEAASAPASKA
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the genomic context of ATP synthase subunit b (atpF) in Saccharopolyspora erythraea?

ATP synthase subunit b (atpF) in S. erythraea is part of the ATP synthase complex encoded within the circular chromosome that comprises 8,212,805 base pairs. The complete genome sequence of S. erythraea revealed that it encodes approximately 7,264 genes, including those involved in energy metabolism such as the ATP synthase operon . The atpF gene is typically organized within an operon containing other ATP synthase subunits, maintaining synteny with related actinomycetes.

For genomic analysis of atpF, researchers should:

  • Use the complete annotated genome sequence (NCBI accession available)

  • Apply comparative genomics approaches to identify conserved regions

  • Analyze the promoter and regulatory elements upstream of the ATP synthase operon

  • Examine codon usage bias which may affect recombinant expression efficiency

How does S. erythraea ATP synthase structure compare to that of other bacterial species?

S. erythraea ATP synthase follows the general F₁F₀ structure common to bacteria but exhibits specific adaptations. Like other F-type ATPases, it contains a membrane-embedded F₀ domain (including subunit b) and a catalytic F₁ domain with alpha and beta subunits arranged in a hexameric ring structure . The alpha and beta subunits contain nucleotide-binding domains responsible for ATP synthesis/hydrolysis.

Structural comparison reveals:

FeatureS. erythraea ATP synthaseModel organisms (E. coli)Other actinomycetes
Subunit bSingle transmembrane domain with extended alpha-helical regionSimilar structure but lower sequence homologyHigher sequence conservation
Gene organizationPart of ATP synthase operonSimilar operon structureSimilar with some variations
Membrane associationAdapted to S. erythraea membrane compositionAdapted to Gram-negative membraneSimilar to other Gram-positive bacteria
Size (aa)~150-160 amino acids (predicted)156 amino acidsVariable (150-170)

To study these structural differences, researchers should employ multiple sequence alignment tools comparing the atpF sequence with homologs from related species, followed by structural prediction algorithms.

What are the primary functional roles of ATP synthase subunit b in S. erythraea?

The ATP synthase subunit b in S. erythraea serves several critical functions:

  • Structural stator: It forms part of the peripheral stalk (stator) that connects the F₁ and F₀ domains of the ATP synthase complex

  • Energy coupling: Helps transmit conformational changes between the proton-translocating F₀ and ATP-synthesizing F₁ domains

  • Assembly scaffold: Provides a platform for the correct assembly of other ATP synthase components

  • Stability maintenance: Contributes to the structural integrity of the entire complex during rotation

The protein plays an essential role in energy metabolism, particularly in oxidative phosphorylation, which is critical for S. erythraea's growth and secondary metabolite production, including erythromycin biosynthesis . Studies in related organisms suggest that disruptions in ATP synthase function can significantly impact cellular energy balance and antibiotic production capacity.

What expression systems are most effective for recombinant S. erythraea atpF production?

The choice of expression system for recombinant S. erythraea atpF requires careful consideration due to its membrane protein nature and potential toxicity when overexpressed.

Recommended expression systems with methodological considerations:

  • E. coli-based systems:

    • BL21(DE3) with pET vectors containing C-terminal His-tag

    • Expression protocol: Induction with 0.1-0.5 mM IPTG at lower temperatures (16-18°C) for 16-20 hours

    • Cultivation in Terrific Broth supplemented with 1% glucose to minimize leaky expression

    • Consider using C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Streptomyces lividans:

    • Better for expressing proteins from high-GC content organisms like S. erythraea

    • pIJ486 or pIJ702 vectors with thiostrepton-inducible promoters

    • Longer expression time (3-5 days) with proper aeration

  • Cell-free expression systems:

    • Particularly useful if cellular toxicity is observed

    • CFCF (Continuous Flow Cell-Free) systems with supplemented lipid nanodiscs

    • Requires optimization of reaction components specific to membrane proteins

The experimental design should include parallel expression trials with different systems, followed by Western blot analysis using anti-His antibodies to assess expression levels and protein integrity.

What purification strategy yields the highest purity and stability for recombinant atpF?

Purification of recombinant S. erythraea atpF requires a specialized approach due to its membrane-associated nature. The following methodological workflow has been optimized:

  • Membrane fraction preparation:

    • Cell disruption by sonication (10 cycles, 30s on/30s off) or French press (15,000 psi)

    • Differential centrifugation: Low-speed (10,000g, 20 min) followed by ultracentrifugation (100,000g, 1 hour)

    • Careful resuspension of membrane pellet in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl

  • Solubilization optimization:

    • Screening of detergents (critical for membrane protein purification):

    DetergentConcentrationSolubilization efficiencyProtein stability
    DDM1%HighExcellent
    LDAO1%MediumGood
    Triton X-1001-2%HighModerate
    Digitonin1%MediumVery good
    • Solubilize at 4°C for 1-2 hours with gentle rotation

  • Multi-step chromatography:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

    • Buffer optimization: Include 0.05% DDM in all buffers to maintain protein solubility

    • Size Exclusion Chromatography as a polishing step using Superdex 200

    • Consider using amphipol A8-35 for final buffer exchange to enhance stability

  • Quality control:

    • SDS-PAGE with Coomassie staining

    • Western blot confirmation

    • Dynamic Light Scattering to assess aggregation state

    • Thermal stability assay using Thermofluor

This purification strategy typically yields >90% pure protein with retention of structural integrity as verified by circular dichroism spectroscopy.

How can researchers overcome aggregation challenges during recombinant atpF purification?

Aggregation is a common challenge when working with membrane proteins like atpF. To overcome this:

  • Prevention strategies during expression:

    • Reduce expression temperature to 16°C

    • Decrease inducer concentration (0.1 mM IPTG)

    • Co-express with molecular chaperones (GroEL/GroES system)

    • Consider fusion partners like MBP (Maltose Binding Protein)

  • Solubilization optimization:

    • Screen multiple detergents systematically

    • Use a detergent:protein ratio of at least 10:1

    • Include glycerol (10%) and reducing agents (5 mM β-mercaptoethanol)

    • Consider mild solubilization (0.5% detergent) over longer periods (overnight at 4°C)

  • During purification:

    • Maintain detergent above CMC (Critical Micelle Concentration) in all buffers

    • Include 10% glycerol throughout purification

    • Apply on-column refolding gradients if inclusion bodies are formed

    • Consider detergent exchange during purification

  • Stabilization post-purification:

    • Reconstitution into nanodiscs or liposomes

    • Use of amphipathic polymers like amphipols

    • Buffer optimization with various salt concentrations (150-300 mM)

    • Storage at higher protein concentrations (>1 mg/ml) to prevent dissociation

Implementing these strategies requires systematic testing and optimization, with protein quality assessment at each step using techniques like dynamic light scattering and analytical size exclusion chromatography.

What methods are most effective for analyzing the structural characteristics of recombinant atpF?

Multiple complementary approaches should be employed for comprehensive structural characterization:

  • Spectroscopic methods:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure content

      • Expected spectrum should show high alpha-helical content (~70%)

      • Method: Far-UV CD (190-260 nm) in detergent-solubilized state

    • FTIR (Fourier Transform Infrared) spectroscopy for additional secondary structure validation

    • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

  • Hydrodynamic and biophysical characterization:

    • Analytical Ultracentrifugation (AUC) to determine oligomeric state

    • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS)

    • Differential Scanning Calorimetry (DSC) for thermal stability assessment

  • High-resolution structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

      • Requires screening of >1000 crystallization conditions

      • Lipidic cubic phase crystallization often more successful than vapor diffusion

    • Cryo-Electron Microscopy (cryo-EM)

      • Single-particle analysis of the entire ATP synthase complex

      • Focused refinement on the stator region containing subunit b

    • Nuclear Magnetic Resonance (NMR) for dynamic structural information

      • Selective isotopic labeling (¹⁵N, ¹³C) required

      • Best for studying the soluble domain of subunit b

  • Computational approaches:

    • Homology modeling based on known bacterial ATP synthase structures

    • Molecular dynamics simulations to assess stability in membrane environment

    • Cross-linking coupled with mass spectrometry to validate structural models

The integration of these methods provides a comprehensive understanding of both static structure and dynamic properties of atpF in its native-like environment.

How can researchers assess the functional integrity of purified recombinant atpF?

Functional integrity assessment requires both binding assays and activity measurements:

  • Interaction analysis with ATP synthase partners:

    • Microscale Thermophoresis (MST) to measure binding affinities with other subunits

    • Surface Plasmon Resonance (SPR) for real-time interaction kinetics

    • Pull-down assays with other recombinant ATP synthase subunits

    • FRET (Förster Resonance Energy Transfer) using fluorescently labeled subunits

  • Reconstitution experiments:

    • Liposome reconstitution of purified atpF with other F₀ components

    • Proton conduction assays using pH-sensitive fluorescent dyes

    • Reconstitution with F₁ components to assess complex formation

  • Functional complementation:

    • Genetic complementation in ATP synthase-deficient bacterial strains

    • Measuring restoration of growth on non-fermentable carbon sources

    • Analysis of ATP synthesis rates in complemented strains

  • Structural integrity probes:

    • Limited proteolysis to assess proper folding

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Accessibility of specific residues to chemical modification

A comprehensive functional assessment would include both in vitro reconstitution experiments and in vivo complementation studies to confirm that the recombinant protein retains native-like functionality.

What techniques can determine if recombinant atpF correctly interacts with other ATP synthase components?

Verifying correct interactions between recombinant atpF and other ATP synthase components requires multiple complementary approaches:

  • In vitro binding assays:

    • Co-immunoprecipitation using tagged versions of different subunits

    • Biolayer Interferometry (BLI) for quantitative binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic binding parameters

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • Visualization techniques:

    • Negative stain electron microscopy of reconstituted complexes

    • Single-molecule FRET to detect conformational changes

    • Fluorescence correlation spectroscopy (FCS) for complex formation

  • Functional complex assembly:

    • ATP synthesis activity measurement in reconstituted proteoliposomes

    • Proton pumping assays using pH-sensitive fluorophores

    • ATPase activity assays (enzyme-coupled systems)

  • Structural verification:

    • Native gel electrophoresis to detect intact complexes

    • Mass photometry for stoichiometric analysis

    • Thermal shift assays to measure complex stability

Experimental design should include appropriate controls:

Control typePurposeImplementation
Negative controlConfirm specificityUse unrelated membrane protein
Mutation controlVerify critical residuesIntroduce point mutations at interaction interface
Competition assayValidate binding sitesUse peptide fragments of interaction domains
Stoichiometry controlEnsure correct assemblyVary ratios of components during reconstitution

How can mutational analysis of S. erythraea atpF advance understanding of ATP synthase function?

Systematic mutational analysis of atpF can provide valuable insights into structure-function relationships:

  • Alanine-scanning mutagenesis approach:

    • Create a library of single alanine substitutions throughout the protein

    • Express and purify each mutant using standardized protocols

    • Assess effects on:

      • Protein expression and stability

      • Complex assembly with partner subunits

      • ATP synthesis/hydrolysis activity

    • Map functional residues onto structural models

  • Targeted mutation of key functional regions:

    • Membrane-spanning domain: Mutations affecting membrane anchoring

    • Coiled-coil region: Mutations disrupting dimerization

    • F₁-interacting domain: Mutations affecting connection to catalytic subunits

    • Conserved charged residues: Potential involvement in proton translocation

  • Experimental design considerations:

    • Use site-directed mutagenesis with optimized primers

    • Express wild-type and mutant proteins in parallel

    • Perform side-by-side purification and characterization

    • Employ both in vitro and in vivo functional assays

  • Data analysis and interpretation:

    • Categorize mutations by effect (expression, stability, assembly, function)

    • Correlate mutational effects with structural features

    • Compare with homologous residues in well-studied ATP synthases

    • Develop a refined model of atpF functional domains

This approach can reveal critical regions for protein-protein interactions, membrane association, and energy coupling within the ATP synthase complex, potentially identifying targets for future bioenergetic engineering.

What role might S. erythraea atpF play in regulating erythromycin biosynthesis?

Understanding the connection between energy metabolism and secondary metabolite production is an emerging research area. The relationship between atpF and erythromycin biosynthesis may involve:

  • Energy coupling mechanisms:

    • ATP synthase generates ATP required for erythromycin biosynthesis

    • The energetic demands of polyketide synthesis are substantial

    • Potential metabolic bottlenecks may occur during antibiotic production

  • Experimental approaches to investigate this relationship:

    • Controlled expression of atpF in S. erythraea strains

    • Monitoring of intracellular ATP/ADP ratios during fermentation

    • Correlation analysis between ATP synthase activity and erythromycin yields

    • Metabolic flux analysis using ¹³C-labeled precursors

  • Gene expression coordination:

    • Transcriptional profiling to detect co-regulation patterns

    • ChIP-seq to identify potential regulatory proteins binding to both gene clusters

    • Reporter gene assays to test promoter activities under different conditions

  • Metabolic engineering implications:

    • Strategic modulation of ATP synthase activity to redirect metabolic flux

    • Balancing primary and secondary metabolism

    • Engineering ATP synthase for improved energy efficiency

Research data from related actinomycetes suggests that energy metabolism and secondary metabolite production are intricately linked. S. erythraea contains at least 25 gene clusters for production of known or predicted secondary metabolites , and proper energy supply through ATP synthase function may be critical for their optimal expression.

How can structural information about S. erythraea atpF contribute to antimicrobial drug discovery?

The ATP synthase complex represents a potentially valuable antimicrobial target, and structural insights from S. erythraea atpF could contribute to drug discovery efforts:

  • Target validation approaches:

    • Essentiality assessment through conditional knockout studies

    • Growth inhibition studies with known ATP synthase inhibitors

    • Comparing conservation between bacterial and human ATP synthases

  • Structure-based drug design strategies:

    • Identification of druggable pockets specific to bacterial atpF

    • Virtual screening against these pockets

    • Fragment-based approaches targeting the interface between atpF and other subunits

    • Rational design of peptide mimetics that disrupt complex assembly

  • Screening methodologies:

    • Development of biochemical assays suitable for high-throughput screening

    • Thermal shift assays to detect compounds binding to atpF

    • Surface plasmon resonance for direct binding assessment

    • Whole-cell assays measuring ATP synthesis inhibition

  • Potential advantages of targeting atpF:

    • Less conserved than catalytic subunits between bacteria and humans

    • Critical for proper complex assembly and function

    • Potential for selectivity between different bacterial species

This research direction could be particularly valuable given the rising problem of antibiotic resistance and the need for new antimicrobial targets, especially against Gram-positive pathogens related to S. erythraea.

How can researchers overcome expression challenges with recombinant S. erythraea atpF?

Membrane proteins like atpF often present significant expression challenges. Here are methodological solutions:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Try different promoter strengths (T7, tac, araBAD)

    • Test various E. coli strains (BL21, C41/C43, Lemo21)

    • Consider fusion partners (MBP, TrxA, SUMO)

    • Supplement media with rare tRNAs if codon bias is an issue

  • Protein toxicity:

    • Use tight expression control (pET vectors with T7-lac promoter)

    • Reduce basal expression with glucose supplementation (0.5-1%)

    • Test auto-induction media for gradual protein production

    • Consider cell-free expression systems

  • Inclusion body formation:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration (0.1 mM IPTG or less)

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Develop refolding protocols if inclusion bodies persist

  • Degradation issues:

    • Add protease inhibitors during all purification steps

    • Test multiple E. coli strains (BL21, Origami)

    • Optimize cell lysis conditions (gentle lysis methods)

    • Consider using protease-deficient host strains

Systematic optimization using Design of Experiments (DoE) methodology is recommended to efficiently identify optimal expression conditions . This approach allows simultaneous evaluation of multiple parameters (temperature, inducer concentration, time, media composition) with minimal experimental runs.

What strategies can address protein degradation during purification of recombinant atpF?

Protein degradation is a common challenge with membrane proteins. The following methodological approaches can mitigate this issue:

  • Preventive measures:

    • Maintain low temperature (4°C) throughout all purification steps

    • Include protease inhibitor cocktail (EDTA-free for IMAC compatibility)

    • Add reducing agents (1-5 mM DTT or TCEP) to prevent oxidative damage

    • Consider adding stabilizing agents (glycerol, arginine, specific lipids)

  • Optimized buffer conditions:

    • Screen pH range (typically 7.0-8.0) for optimal stability

    • Test various salt concentrations (150-500 mM NaCl)

    • Include specific lipids that may co-purify with the native protein

    • Avoid harsh elution conditions (use gradient elution in IMAC)

  • Purification strategy modifications:

    • Use rapid purification protocols to minimize exposure time

    • Consider on-column detergent exchange

    • Implement gentle elution methods

    • Test various chromatography resins and conditions

  • Analytical approaches to monitor degradation:

    • Regular SDS-PAGE samples during purification

    • Western blot with antibodies against N- and C-terminal tags

    • Mass spectrometry to identify degradation products

    • Size-exclusion chromatography to monitor aggregation

If degradation persists despite these measures, consider structural biology approaches like limited proteolysis to identify stable domains that could be expressed separately.

How can researchers validate that their recombinant atpF retains native conformation?

Validating native-like conformation of recombinant membrane proteins requires multiple lines of evidence:

  • Biophysical characterization:

    • Circular Dichroism (CD) spectroscopy to confirm secondary structure content

      • Expected: High alpha-helical content (~70%)

      • Compare with predictions from homology models

    • Intrinsic fluorescence spectroscopy to assess tertiary fold

    • Differential Scanning Calorimetry for thermal stability profile

    • Analytical ultracentrifugation for oligomeric state

  • Functional validation:

    • Binding assays with known interaction partners

    • ATP synthase activity assays in reconstituted systems

    • Proton translocation measurements

    • Complementation of atpF-deficient bacterial strains

  • Structural probes:

    • Limited proteolysis patterns compared to native protein

    • Accessibility of cysteine residues to modification reagents

    • Hydrogen-deuterium exchange mass spectrometry profiles

    • Epitope recognition by conformation-specific antibodies

  • Comparative analysis:

    • Side-by-side comparison with native ATP synthase (if available)

    • Comparison with published data on homologous proteins

    • Correlation between structural and functional parameters

A multi-parameter validation approach is essential, as no single technique can definitively confirm native conformation. Researchers should establish a minimum set of criteria that must be met to consider the recombinant protein conformationally native.

How might genetic engineering of S. erythraea atpF impact antibiotic production?

Engineering atpF could potentially enhance erythromycin production through several mechanisms:

  • Energy efficiency optimization:

    • Targeted mutations to improve ATP synthesis efficiency

    • Fine-tuning of expression levels to balance energy production with consumption

    • Coordinate expression with erythromycin biosynthetic gene cluster

  • Experimental approaches:

    • Site-directed mutagenesis of conserved residues

    • Promoter engineering for controlled expression

    • Integration of additional copies under inducible control

    • CRISPR-Cas9 genome editing for precise modifications

  • Metabolic consequences to monitor:

    • ATP/ADP ratio during fermentation

    • NADH/NAD⁺ balance

    • Precursor availability for erythromycin biosynthesis

    • Growth rate and biomass accumulation

  • Industrial relevance:

    • Potential for increased antibiotic yields

    • Improved fermentation efficiency

    • Reduced production costs

    • Enhanced strain stability

S. erythraea contains at least 25 gene clusters for production of known or predicted secondary metabolites and at least 72 genes predicted to confer resistance to a range of common antibiotic classes . Engineering its energy metabolism through atpF modifications represents a promising approach for strain improvement without directly manipulating the complex biosynthetic pathways.

What comparative insights can be gained by studying atpF across different Saccharopolyspora species?

Comparative analysis of atpF across Saccharopolyspora species can provide valuable evolutionary and functional insights:

  • Evolutionary conservation patterns:

    • Identification of absolutely conserved residues (likely essential for function)

    • Variable regions that may relate to species-specific adaptations

    • Correlation between sequence conservation and known functional domains

  • Methodological approach:

    • Multiple sequence alignment of atpF from S. erythraea, S. spinosa, and other related species

    • Phylogenetic analysis to trace evolutionary relationships

    • Structural modeling to map conservation onto 3D structure

    • Selection pressure analysis (dN/dS ratios) to identify regions under evolutionary constraint

  • Functional comparisons:

    • Expression and purification of atpF from multiple species

    • Biophysical characterization to compare stability and structure

    • Cross-species complementation experiments

    • Chimeric protein construction to map functional domains

  • Biotechnological implications:

    • Identification of superior variants for heterologous expression

    • Understanding of species-specific adaptations in energy metabolism

    • Potential for creating optimized chimeric proteins with enhanced properties

This comparative approach could reveal how differences in ATP synthase components relate to the distinct metabolic capabilities of different Saccharopolyspora species, particularly in relation to their diverse secondary metabolite production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.