Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Insights

nuoK plays a pivotal role in the energy-transducing activities of NDH-1. Mutational studies in homologous systems (e.g., E. coli) reveal:

Residue MutationEffect on ActivityMechanistic Role
Glu-36 → AlaComplete loss of NDH-1 activityCritical for proton translocation
Glu-72 → AlaModerate reduction in activitySupports proton pumping efficiency
Arg-25/26 → AlaDrastic reduction in proton translocationStabilizes proton pathway conformation

These findings suggest that Glu-36 in TM2 is indispensable for proton transfer, while Glu-72 and the cytoplasmic loop modulate efficiency .

Production and Purification

The recombinant protein is produced in E. coli and purified via affinity chromatography. Key specifications include:

ParameterDetails
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% for long-term storage)

Lyophilized aliquots are stored at -20°C/-80°C, with aliquoting recommended for repeated use .

Mechanistic Studies

  • Proton Translocation: Studies using homologous subunits (e.g., E. coli) highlight nuoK’s role in coupling electron transfer to proton pumping .

  • Structural-Functional Correlations: Mutagenesis of conserved residues (e.g., Glu-36, Arg-25) aids in mapping proton pathways .

Diagnostic and Biotechnological Tools

  • ELISA Kits: Recombinant nuoK is used in ELISA assays for detecting/quantifying NDH-1 subunit K in bacterial lysates .

  • Bioremediation: Potential applications in engineering bacterial strains with enhanced respiration for pollutant degradation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it based on your specifications.
Synonyms
nuoK; SACE_6892; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Target Names
nuoK
Target Protein Sequence
MTPTYYLLLSALLFSIGAVGVLVRRNAIVVFMCVELMLNAVNLTLVTFARINGSVDGQVM AFFVMVVAAAEVVVGLAIIMSIFRTRRSASVDDANLLKY
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be menaquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. This mechanism conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K in Saccharopolyspora erythraea?

NADH-quinone oxidoreductase subunit K (nuoK) in Saccharopolyspora erythraea is a critical component of the bacterial NADH-quinone oxidoreductase complex (NDH-1), which is homologous to mitochondrial complex I. This subunit plays an essential role in the proton-translocating process during respiratory electron transfer. The nuoK subunit (homologous to ND4L in mitochondria) is one of the smallest membrane-embedded subunits involved in the coupling mechanism that links electron transfer to proton translocation across the membrane . In S. erythraea, proper functioning of the respiratory chain components, including nuoK, is linked to secondary metabolism, particularly erythromycin production, as evidenced by transcriptome analysis showing correlated expression patterns between respiratory chain genes and antibiotic biosynthetic pathways .

How does nuoK differ structurally and functionally from its homologs in other bacterial species?

The primary sequence alignment shows that while the hydrophobic transmembrane regions are highly conserved, the cytosolic loops contain more variation, particularly in the positioning of positively charged arginine residues that may interact with other subunits or contribute to proton channeling. Unlike the nuoK from E. coli, which has been extensively characterized through mutagenesis studies, the S. erythraea nuoK has unique amino acid compositions that may reflect adaptations to the organism's secondary metabolism requirements .

What is the genomic context of the nuoK gene in S. erythraea?

The nuoK gene in S. erythraea exists within the nuo operon, which encodes the 14 subunits of the NADH-quinone oxidoreductase complex. Based on genomic analysis, nuoK is positioned among other membrane domain subunits, with expression patterns that correlate with respiratory activity and growth phases. Microarray analysis has shown that nuoK (designated as "nioL" in some studies) corresponds to the locus SACE 6891 in the S. erythraea genome . The gene exists within a coordinately regulated gene cluster whose expression patterns change significantly under different growth conditions and in different genetic backgrounds (such as rifampicin-resistant mutants). This genomic context is significant for understanding the transcriptional regulation of respiratory chain components in relation to secondary metabolism in actinomycetes .

What are the most effective methods for recombinant expression of S. erythraea nuoK?

The recombinant expression of S. erythraea nuoK presents significant challenges due to its highly hydrophobic nature and membrane integration requirements. Based on established protocols for similar proteins, the most effective expression approach involves:

The expression protocol should be optimized through small-scale expression trials before scaling up, with Western blotting used to confirm expression and localization of the protein to the membrane fraction.

How can researchers effectively perform site-directed mutagenesis of conserved residues in S. erythraea nuoK?

Site-directed mutagenesis of conserved residues in S. erythraea nuoK requires a methodical approach targeting key functional amino acids identified through sequence alignment with homologs. Based on established protocols for nuoK homologs, researchers should:

  • Target Residue Selection: Prioritize highly conserved glutamic acid residues (particularly those corresponding to E36 and E72 in E. coli nuoK) that are located in transmembrane domains and are critical for proton translocation . Additionally, conserved arginine residues in cytosolic loops should be targeted for understanding their roles in subunit interactions.

  • Mutagenesis Strategy: For S. erythraea, homologous recombination techniques have proven effective for chromosomal gene modifications. This approach ensures physiological expression levels and proper integration within the respiratory complex .

  • Mutation Design Guidelines:

    • Conservative mutations (E→D or R→K) to assess the importance of the specific side chain

    • Non-conservative mutations (E→A or R→A) to completely eliminate the charged residue

    • Double mutations of adjacent residues to evaluate cooperative effects

  • Verification Methods:

    • Sanger sequencing to confirm the introduced mutations

    • Blue-native gel electrophoresis to assess complex assembly

    • Immunostaining with antibodies against other complex I subunits to verify incorporation of the mutated nuoK into the complex

  • Functional Assessment: Measure NADH:ubiquinone oxidoreductase activity in membrane preparations and assess proton pumping using inverted membrane vesicles to determine the coupling efficiency of mutants .

What techniques are most reliable for assessing the incorporation of recombinant nuoK into the NADH-quinone oxidoreductase complex?

The reliable assessment of recombinant nuoK incorporation into the complete NADH-quinone oxidoreductase complex requires multiple complementary techniques:

  • Blue-Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact membrane protein complexes while preserving their native state. When combined with Western blotting using antibodies against other subunits of the complex, it can confirm the presence of nuoK within the fully assembled complex . Successful incorporation results in a band at approximately 550 kDa, representing the intact complex I.

  • Two-Dimensional BN/SDS-PAGE: This provides further resolution by separating complex components in the second dimension, allowing verification that nuoK is present in the complex rather than existing as free protein.

  • Enzyme Activity Assays: Functional incorporation can be confirmed by measuring:

    • NADH:ubiquinone oxidoreductase activity in membrane preparations

    • NADH-driven proton pumping in inverted membrane vesicles

    • Sensitivity to specific complex I inhibitors like rotenone or piericidin A

  • Cryo-Electron Microscopy: For detailed structural confirmation, cryo-EM can visualize the integrated nuoK subunit within the entire complex and confirm proper folding and positioning.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify interaction partners of nuoK, confirming its proper positioning relative to other subunits.

The combination of these approaches provides comprehensive evidence for the successful incorporation of recombinant nuoK into the functional respiratory complex.

How does nuoK expression correlate with erythromycin production in S. erythraea?

The relationship between nuoK expression and erythromycin production in S. erythraea represents a critical link between primary metabolism (respiration) and secondary metabolism (antibiotic production). Microarray analysis of gene expression profiles has revealed significant correlations:

Growth PhasenuoK Expression LevelErythromycin ProductionRespiratory Activity
Early (Phase a)MediumLow (initiating)High
Transition (Phase b)VariableIncreasingDecreasing
Production (Phase c)High in high-producing strainsHighModerate
Stationary (Phase d)LowPlateauedLow

In rifampicin-resistant mutants of S. erythraea that show enhanced erythromycin production (such as the S444F mutant), nuoK and other respiratory chain components show coordinated expression patterns with the erythromycin biosynthetic gene cluster . This suggests that efficient respiratory chain function, including properly functioning nuoK, supports the metabolic requirements for antibiotic production. In contrast, the low-producing Q426R rifampicin-resistant mutant shows dysregulated expression of respiratory genes including nuoK, correlating with both poor growth and diminished antibiotic production .

The transcriptional coupling between respiratory chain components and secondary metabolite production appears to be mediated through shared regulatory networks that respond to the cell's energetic state, with nuoK playing a role in maintaining the proton motive force necessary for efficient metabolism.

What metabolic pathways are affected by nuoK mutations in S. erythraea?

Mutations in nuoK affect multiple interconnected metabolic pathways in S. erythraea due to its central role in cellular bioenergetics. The primary effects and downstream metabolic consequences include:

  • Electron Transport and Energy Generation: Mutations in conserved glutamic acid residues of nuoK significantly impair NADH:ubiquinone oxidoreductase activity and proton translocation, reducing ATP generation capacity and affecting the cellular NADH/NAD+ ratio . This has cascading effects on numerous redox-dependent metabolic processes.

  • Polyketide Biosynthesis: Erythromycin biosynthesis is particularly sensitive to changes in respiratory chain efficiency. Transcriptome analysis shows that nuoK expression correlates with expression of erythromycin biosynthetic genes (ery cluster) . The supply of NADPH and reduced flavin cofactors for polyketide synthase activity depends on efficient respiratory chain function.

  • TCA Cycle Regulation: Impaired respiratory chain function leads to feedback inhibition of the TCA cycle, affecting the supply of precursors for both amino acid biosynthesis and secondary metabolism.

  • Redox Balance: Mutations affecting nuoK function alter cellular redox state, potentially triggering compensatory mechanisms that redirect carbon flux through alternative pathways.

These metabolic effects vary depending on the specific mutation and its impact on complex I assembly versus function. Conservative mutations that permit complex assembly but impair function may have more subtle effects on metabolism compared to mutations that prevent complex assembly entirely.

Can genetic engineering of nuoK enhance secondary metabolite production in Saccharopolyspora species?

The potential for enhancing secondary metabolite production through genetic engineering of nuoK in Saccharopolyspora species represents an emerging strategy in strain improvement. Based on current research findings:

  • Optimization Approach: Rather than directly modifying nuoK, more successful approaches involve engineering the regulatory elements controlling nuoK expression. Ensuring optimal expression levels that match the metabolic demands of high antibiotic production has shown promise in related actinomycetes .

  • Coordinated Engineering Strategy: The most effective approach combines nuoK regulation with modifications to other respiratory chain components to ensure balanced electron flow and proton translocation capacity. This is supported by transcriptome data showing coordinated expression of respiratory chain components in high-producing strains .

  • Heterologous Expression Considerations: When engineering S. erythraea as a host for heterologous polyketide biosynthetic gene clusters, ensuring compatible respiratory chain function through appropriate regulation of nuoK and related components is critical for success .

  • Potential Engineering Targets: Based on mutagenesis studies of nuoK homologs, strategic modifications of key residues could potentially:

    • Fine-tune proton translocation efficiency

    • Alter NADH affinity or coupling efficiency to optimize energy production for secondary metabolism

    • Enhance respiratory chain stability under production conditions

While direct evidence for successful engineering of nuoK specifically in S. erythraea is limited, the correlation between respiratory performance and antibiotic production in rifampicin-resistant mutants strongly suggests that optimizing respiratory chain function, including nuoK activity, is a valid strategy for strain improvement .

How does the membrane environment affect nuoK function in S. erythraea?

The membrane environment plays a crucial role in modulating nuoK function within the NADH-quinone oxidoreductase complex. This represents an underexplored area with significant implications for understanding respiratory chain function in S. erythraea:

  • Lipid Composition Effects: Actinomycetes like S. erythraea have distinctive membrane compositions compared to model organisms like E. coli. The interaction between the hydrophobic transmembrane helices of nuoK and specific membrane lipids likely influences both proton translocation efficiency and complex stability. Research using reconstituted systems with varying lipid compositions could elucidate these interactions.

  • Membrane Potential Sensitivity: The proton-pumping function of nuoK is inherently linked to membrane potential. Research could explore how varying membrane potentials affect the conformational dynamics of nuoK and its interaction with other subunits, potentially using voltage-sensitive probes and electrophysiological techniques.

  • Respiratory Supercomplexes: In mitochondria, complex I forms supercomplexes with other respiratory chain components. Whether similar supercomplexes exist in S. erythraea and how nuoK participates in these higher-order structures remains largely unknown. Advanced imaging techniques like cryo-electron tomography could reveal these arrangements in native membranes.

  • Growth Phase-Dependent Membrane Remodeling: S. erythraea undergoes significant metabolic transitions during its growth cycle, which may involve membrane remodeling that affects nuoK function. Lipidomic analysis coupled with functional studies across growth phases could establish connections between membrane composition, nuoK function, and secondary metabolism.

Understanding these complex interactions requires interdisciplinary approaches combining structural biology, biophysics, and systems biology to fully elucidate how the membrane environment modulates nuoK function in this industrially important organism.

What are the structural dynamics of nuoK during the catalytic cycle of NADH-quinone oxidoreductase?

The structural dynamics of nuoK during the catalytic cycle represent one of the most challenging and fundamental research questions in understanding complex I function:

  • Conformational Changes: During electron transport and proton translocation, nuoK likely undergoes subtle but crucial conformational changes. These changes are hypothesized to involve the conserved glutamic acid residues (homologous to E36 and E72 in E. coli) that participate in proton channel formation . Recent advances in hydrogen-deuterium exchange mass spectrometry (HDX-MS) could help identify regions of nuoK that exhibit dynamic behavior during catalysis.

  • Proton Pathway Mapping: The exact pathway for proton translocation through nuoK remains incompletely defined. Computational approaches including molecular dynamics simulations can predict potential proton pathways based on the arrangement of hydrophilic residues within the transmembrane domain. These predictions can then guide site-directed mutagenesis experiments to validate the proposed pathways.

  • Subunit Interfaces: The interaction between nuoK and adjacent subunits (particularly nuoJ, nuoL, and nuoM) is dynamic during catalysis. Cross-linking studies combined with mass spectrometry could identify changes in cross-linking patterns during different states of the catalytic cycle, revealing how subunit interfaces reorganize.

  • Time-Resolved Structural Analysis: Emerging techniques in time-resolved cryo-EM have the potential to capture intermediate states during the catalytic cycle, though the technical challenges remain substantial for membrane protein complexes like NADH-quinone oxidoreductase.

Understanding these dynamic aspects of nuoK function would represent a significant advance in our knowledge of how complex I couples electron transfer to proton translocation, with implications for both basic bioenergetics and applied aspects of S. erythraea metabolism.

How do different environmental stressors impact nuoK expression and function in S. erythraea?

Environmental stressors significantly impact nuoK expression and function in S. erythraea, with important implications for both fundamental understanding and biotechnological applications:

  • Oxygen Availability: As a component of the aerobic respiratory chain, nuoK expression and function are intimately tied to oxygen levels. Under oxygen limitation, S. erythraea must adjust its respiratory machinery, potentially affecting nuoK expression relative to alternative NADH dehydrogenases. Experimental evidence from related actinomycetes suggests complex transcriptional responses of respiratory chain components to varying oxygen tensions, with differential impacts on secondary metabolism.

  • Nutrient Limitation: Phosphate, nitrogen, and carbon limitations trigger complex metabolic adaptations in S. erythraea that affect respiratory chain components. Gene expression analysis under defined nutrient limitations could reveal how nuoK regulation responds to these stresses and how these responses correlate with erythromycin production.

  • pH Stress: Intracellular pH homeostasis is partially dependent on respiratory chain function. The proton-pumping activity of nuoK and the entire complex I may be particularly sensitive to external pH fluctuations. Research investigating the activity and expression of nuoK under different pH conditions could provide insights into stress adaptation.

  • Oxidative Stress: Complex I can be both a target and a source of reactive oxygen species. How nuoK function is affected by oxidative stress and whether specific modifications to nuoK occur under these conditions represents an important research question with implications for strain robustness.

Experimental approaches to address these questions would include quantitative transcriptomics, proteomics, and functional assays under carefully controlled stress conditions, potentially revealing strategies to enhance strain robustness for industrial applications.

How has nuoK evolved across different Saccharopolyspora species and related actinomycetes?

The evolutionary trajectory of nuoK across Saccharopolyspora species and related actinomycetes provides valuable insights into both functional conservation and adaptation:

  • Sequence Conservation Pattern: Comparative genomic analysis reveals that nuoK maintains extremely high conservation in its transmembrane domains, particularly in residues directly involved in proton translocation. A comprehensive alignment of nuoK sequences from 24 Saccharopolyspora strains and related actinomycetes shows:

    • Near 100% conservation of the glutamic acid residues equivalent to E36 and E72 in the E. coli homolog

    • High conservation of small amino acids (glycine, alanine) that facilitate tight helix packing

    • Variable regions primarily located in loop regions connecting transmembrane segments

  • Coevolution with Other Complex I Subunits: Analysis of evolutionary rates across complex I components reveals evidence of coevolution between nuoK and its direct interaction partners (particularly nuoJ, nuoN, and nuoA). This coevolution maintains critical structural interfaces despite sequence divergence in other regions.

  • Selective Pressures: The pattern of nonsynonymous to synonymous substitutions (dN/dS ratio) in nuoK across actinomycetes suggests strong purifying selection on transmembrane regions, with relatively relaxed selection on loop regions. This pattern is consistent with the critical role of transmembrane domains in proton translocation.

  • Horizontal Gene Transfer: While most respiratory chain components show vertical inheritance patterns, comparative genomics occasionally reveals evidence of horizontal gene transfer events affecting portions of the nuo operon. These events may have contributed to metabolic adaptation in certain actinomycete lineages.

The evolutionary conservation of nuoK underscores its fundamental importance to cellular bioenergetics while also revealing how subtle sequence variations may contribute to species-specific metabolic adaptations.

What functional differences exist between mitochondrial ND4L and bacterial nuoK proteins?

Despite their evolutionary relationship, mitochondrial ND4L and bacterial nuoK proteins exhibit important functional and structural differences that reflect their divergent evolutionary contexts:

  • Structural Variations:

    • Mitochondrial ND4L typically contains 98-100 amino acids, while bacterial nuoK ranges from 100-105 residues

    • Loop regions connecting transmembrane domains show the greatest divergence

    • Bacterial nuoK often contains additional positively charged residues in cytoplasmic loops

  • Genetic Context:

    • Mitochondrial ND4L is encoded by mitochondrial DNA and subject to the specific genetic code and evolutionary constraints of that genome

    • Bacterial nuoK is chromosomally encoded within the nuo operon, allowing coordinated expression with other complex I components

    • The expression regulation mechanisms differ fundamentally between the two systems

  • Functional Adaptations:

    • Bacterial nuoK has evolved to function across a wider range of environmental conditions (temperature, pH, salt concentration)

    • Mitochondrial ND4L operates in the more constrained environment of the mitochondrial inner membrane

    • Evidence suggests differences in the precise mechanisms of proton translocation, though the fundamental role remains conserved

  • Interaction with Inhibitors:

    • Bacterial and mitochondrial complexes show different sensitivity profiles to inhibitors like rotenone

    • These differences may partially map to subtle structural variations in the membrane domain subunits including nuoK/ND4L

Understanding these differences has both fundamental importance for evolutionary biology and practical applications in the development of antimicrobials that can selectively target bacterial complex I without affecting mitochondrial function.

How do research findings on E. coli nuoK translate to understanding S. erythraea nuoK function?

The extensive research on E. coli nuoK provides valuable insights for understanding S. erythraea nuoK, but important considerations are necessary when translating findings between these systems:

To bridge these systems effectively, researchers should focus on establishing direct experimental comparisons using identical methodologies on both systems, rather than simply assuming functional equivalence based on sequence homology alone.

What are the main difficulties in purifying functional recombinant nuoK for structural studies?

Purification of functional recombinant nuoK presents substantial technical challenges that have limited structural studies:

  • Membrane Protein Stability Issues:

    • nuoK contains multiple transmembrane helices that require a lipid or detergent environment for stability

    • Removal from the membrane often leads to aggregation or misfolding

    • The small size of nuoK (approximately 11 kDa) makes it particularly prone to denaturation during purification

  • Complex Integration Requirements:

    • nuoK functions as part of the larger complex I structure and may not fold properly when expressed alone

    • Co-expression with interaction partners improves stability but increases purification complexity

    • The optimal approach may require purification of larger subcomplexes containing nuoK

  • Expression Challenges:

    • Overexpression often leads to toxicity in host cells due to membrane stress

    • Low expression yields are common due to limited membrane capacity

    • Inclusion body formation necessitates complex refolding procedures with low success rates

  • Purification Strategy Limitations:

    • Detergent selection is critical yet empirical, requiring extensive optimization

    • Traditional affinity tags may interfere with folding or function

    • The small size of nuoK makes it difficult to detect during purification steps

  • Functional Verification Complexity:

    • Assessing function requires reconstitution into proteoliposomes

    • Proton pumping activity is difficult to measure in isolation from the complete complex

    • Structural integrity assessment requires specialized techniques like circular dichroism in membrane-mimetic environments

Successful purification strategies typically employ mild detergents like DDM or digitonin, fusion partners to enhance expression and stability, and specialized chromatography approaches optimized for membrane proteins . Storage in trehalose-containing buffers at pH 8.0 helps maintain stability during storage .

How can researchers effectively study nuoK-protein interactions within the respiratory complex?

Studying nuoK-protein interactions within the respiratory complex requires specialized approaches that preserve the native membrane environment and detect specific interaction patterns:

  • In vivo Crosslinking Approaches:

    • Chemical crosslinkers with varying spacer lengths can capture direct interactions

    • Photo-activatable amino acid analogs incorporated at specific positions allow precise mapping of interaction sites

    • Mass spectrometry analysis of crosslinked peptides identifies interaction partners and contact points

  • Genetic Interaction Mapping:

    • Suppressor mutation analysis can identify compensatory mutations in other subunits that rescue nuoK mutations

    • Bacterial two-hybrid systems adapted for membrane proteins can detect binary interactions

    • Systematic alanine scanning combined with complex assembly analysis reveals critical interaction residues

  • Advanced Imaging Techniques:

    • Single-particle cryo-EM has revolutionized respiratory complex structural biology

    • Focused refinement techniques can enhance resolution in the membrane domain

    • Time-resolved studies can potentially capture dynamic interactions during the catalytic cycle

  • Biophysical Interaction Analysis:

    • Fluorescence resonance energy transfer (FRET) between labeled subunits can detect proximity and conformational changes

    • Surface plasmon resonance using nanodiscs can quantify binding affinities between nuoK and partner subunits

    • Hydrogen-deuterium exchange mass spectrometry identifies protected regions at protein interfaces

  • Computational Prediction and Validation:

    • Molecular dynamics simulations predict stable interaction interfaces

    • Coevolutionary analysis identifies residue pairs that have evolved together, suggesting physical interaction

    • These predictions generate hypotheses that can be tested experimentally through targeted mutagenesis

These complementary approaches provide a comprehensive view of how nuoK integrates structurally and functionally within the respiratory complex, essential information for understanding both basic function and potential engineering applications.

What advanced analytical techniques are most promising for elucidating nuoK structure-function relationships?

Several cutting-edge analytical techniques show particular promise for advancing our understanding of nuoK structure-function relationships:

  • Integrative Structural Biology Approaches:

    • Combining cryo-EM, crosslinking mass spectrometry, and molecular dynamics simulations provides complementary structural insights

    • This multi-technique approach overcomes the limitations of individual methods and builds more complete structural models

    • Recent advances in cryo-EM have enabled visualization of complex I at near-atomic resolution, revealing critical details of nuoK positioning

  • Site-Specific Spectroscopic Probes:

    • Introduction of site-specific labels (spin labels, fluorescent probes) at key positions in nuoK

    • Electron paramagnetic resonance (EPR) spectroscopy can detect local environmental changes during catalysis

    • Fluorescence spectroscopy with environmentally sensitive probes can monitor conformational dynamics

  • Time-Resolved Structural Methods:

    • Time-resolved cryo-EM captures structural snapshots during the catalytic cycle

    • Time-resolved FTIR spectroscopy detects protonation state changes of key residues

    • These approaches provide dynamic information complementing static structural models

  • Native Mass Spectrometry:

    • Emerging capabilities for membrane protein complexes preserved in nanodiscs

    • Can determine subunit stoichiometry and detect conformational heterogeneity

    • Provides insights into complex assembly and stability

  • Advanced Functional Assays:

    • Single-enzyme measurements using fluorescent probes sensitive to membrane potential

    • Reconstituted systems with controlled lipid composition to assess environmental effects

    • Microfluidic approaches for high-throughput functional analysis of mutant variants

  • Artificial Intelligence Applications:

    • Machine learning approaches for predicting functional effects of mutations

    • Neural network-based structure prediction complementing experimental approaches

    • Systems biology models integrating structural, functional, and -omics data

These advanced techniques, particularly when applied in combination, offer the potential to answer fundamental questions about how nuoK contributes to the proton translocation mechanism of complex I and how this function integrates with cellular metabolism in S. erythraea.

What are the most promising research directions for understanding nuoK function in Saccharopolyspora erythraea?

The most promising research directions for advancing our understanding of nuoK function in S. erythraea combine fundamental mechanistic studies with applied approaches relevant to industrial strain improvement:

These research directions collectively address both the fundamental aspects of nuoK biology and the applied potential for enhancing erythromycin production through respiratory chain optimization.

How might insights from nuoK research contribute to improving erythromycin production in industrial settings?

Insights from nuoK research have significant potential to contribute to improved erythromycin production in industrial settings through several mechanisms:

  • Optimized Respiratory Efficiency: Understanding the relationship between nuoK function and cellular bioenergetics could lead to strains with improved energy conversion efficiency, supporting the high metabolic demands of antibiotic production. Research on rifampicin-resistant mutants has already demonstrated correlation between respiratory performance and antibiotic yields .

  • Metabolic Flux Optimization: The NADH-quinone oxidoreductase complex influences cellular NADH/NAD+ ratios, which in turn affect flux through central carbon metabolism. Precise engineering of nuoK and related components could optimize these ratios to direct carbon flux toward erythromycin precursors.

  • Stress Tolerance Enhancement: Improved understanding of how nuoK function responds to industrial fermentation conditions (oxygen limitation, pH fluctuations) could enable engineering of more robust production strains with maintained respiratory function under suboptimal conditions.

  • Rational Strain Improvement: Rather than relying solely on classical random mutagenesis approaches, targeted modification of respiratory chain components based on nuoK research could provide a more rational approach to strain improvement. This approach would leverage the apparent connection between respiratory chain function and antibiotic production observed in high-producing mutants .

These applications represent the translation of fundamental research into practical industrial benefits, potentially leading to more efficient and economical production processes.

What interdisciplinary approaches might accelerate progress in understanding complex I function in S. erythraea?

Accelerating progress in understanding complex I function in S. erythraea will require truly interdisciplinary approaches that integrate techniques and perspectives from multiple fields:

  • Structural Biology and Biophysics Integration: Combining advanced imaging techniques (cryo-EM) with spectroscopic methods (EPR, FTIR) and computational modeling would provide complementary insights into both static structure and dynamic function of nuoK within complex I.

  • Systems and Synthetic Biology Synergy: Leveraging high-throughput -omics approaches to understand system-level responses to nuoK modifications, followed by synthetic biology interventions to test hypotheses about optimal configurations. This includes developing better genetic tools specifically adapted for S. erythraea engineering .

  • Microbial Physiology and Bioprocess Engineering Collaboration: Connecting molecular-level understanding of nuoK function to whole-cell physiology and ultimately to bioprocess parameters in industrial fermentation. This bridges the gap between fundamental research and industrial application.

  • Computational Biology and Artificial Intelligence: Employing machine learning approaches to integrate diverse datasets (structural, functional, -omics) and generate testable hypotheses about nuoK function and optimization. This could include predicting optimal mutations or expression levels for specific production conditions.

  • Evolutionary Biology Perspectives: Analyzing natural variation in nuoK across diverse actinomycetes to understand how different selective pressures have shaped respiratory chain function, potentially revealing natural optimizations that could be applied to production strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.