Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Catalytic Role

UppP belongs to the hydrolase family (EC 3.6.1.27) and is a membrane-bound protein. Its primary function is to regenerate Und-P from Und-PP, enabling efficient recycling of the lipid carrier for subsequent glycan polymer synthesis .

Key Features:

PropertyDetail
Catalytic ReactionUnd-PP + H₂O → Und-P + Pi
CofactorsRequires Mg²⁺ or Ca²⁺ for optimal activity
Subcellular LocationIntegral membrane protein with periplasmic-facing active site

In S. erythraea, uppP is recombinant, often expressed with tags (e.g., bacteriorhodopsin) for purification .

Sequence and Topology

The S. erythraea uppP sequence spans 273 amino acids (Uniprot: A4FFN9) . Key motifs include:

  • Conserved Motifs: (E/Q)XXXE and PGXSRSXXT regions critical for substrate binding and catalysis .

  • Active Site: Composed of glutamates, serine, arginine, and threonine residues, with a histidine residue likely stabilizing the pyrophosphate group .

Comparative Analysis with E. coli UppP

FeatureS. erythraea UppPE. coli UppP
ExpressionRecombinant production in E. coli Native or recombinant in E. coli
Catalytic EfficiencyUndetermined75% of total cellular activity
Substrate SpecificityUnd-PP → Und-PUnd-PP → Und-P

Role in Secondary Metabolite Biosynthesis

In S. erythraea, uppP is implicated in maintaining the Und-P pool, which is essential for synthesizing antibiotics like erythromycin . Genetic studies show that modifying tailoring enzymes (e.g., eryK, eryG) in S. erythraea enhances antibiotic production, indirectly highlighting the importance of cell wall integrity .

Active Site Mutagenesis

In E. coli, mutations in conserved residues (e.g., E17A, H30A, S173A) abolish uppP activity, confirming their role in substrate binding and catalysis . While S. erythraea uppP remains understudied, similar conserved motifs suggest analogous mechanisms .

Periplasmic Localization

The acid phosphatase motifs in E. coli uppP face the periplasm, enabling dephosphorylation of Und-PP released during glycan polymer transfer . This topology likely applies to S. erythraea uppP, though experimental validation is needed.

Antibiotic Resistance and Stress Response

UppP activity is linked to bacitracin resistance, as bacitracin inhibits Und-PP dephosphorylation . In S. erythraea, understanding uppP’s role in stress responses (e.g., Und-P depletion) could inform strategies to enhance antibiotic yield .

CRISPR-Cas9 Applications

Genome editing in S. erythraea (e.g., deleting ery clusters) may alter Und-P dynamics, necessitating uppP modulation to optimize secondary metabolite production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; SACE_3590; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Target Names
uppP
Target Protein Sequence
MQAMVLAVVQGLTEFLPISSSGHLSIVSKLFFGSDAGASFTAVTQIGTELAVVIYFAGDI VRLVVTWFRGLVNAEVRRTQDYRLAWYVIVGSLPIGVLGFLFQDYIRGALRSLWITGAML ILFGILMGLAERFGAQRRGHDKLTMRDGVLMGSAQALALIPGVSRSGGTITAGLSLGLDR PTAVRFSFLLAIPAVFAAGVSEVSHVFEPSAHGLQPTGAQMIVATVVAGVVGYAVIAWLL RYVQKHSVYLFVWYRIVLGLVLFGLLGFGVIQP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the uppP gene organized and expressed in S. erythraea?

The uppP gene in S. erythraea exists within a complex genomic context that influences its expression pattern. Gene expression profiling studies have revealed that S. erythraea exhibits three distinct growth phases: a rapid growth until 32h (phase A), a growth slowdown until 52h (phase B), and another rapid growth phase from 56h to 72h (phase C) before entering the stationary phase . The expression of metabolic genes, including those involved in cell wall synthesis like uppP, is coordinated with these growth phases.

Research methodologies for studying uppP expression include:

  • Transcriptional analysis using DNA microarrays designed specifically for S. erythraea

  • Quantitative RT-PCR for targeted expression analysis

  • RNA-seq for genome-wide transcriptional profiling

  • Reporter gene fusions to study promoter activity

Expression of uppP may be influenced by key transcriptional regulators such as BldD, which has been identified as a developmental regulator in S. erythraea that controls erythromycin biosynthesis . Additionally, secondary messengers like (p)ppGpp and c-di-GMP play important roles in regulating gene expression in S. erythraea in response to nutrient limitation .

What expression systems are most effective for producing recombinant S. erythraea uppP?

Several expression systems can be employed for producing recombinant S. erythraea uppP, each with specific advantages:

Table 1: Comparison of Expression Systems for Recombinant S. erythraea uppP

Expression SystemAdvantagesDisadvantagesRecommended VectorsTypical Yield
E. coliRapid growth, simple genetics, well-established protocolsPotential improper folding of membrane proteins, lack of actinomycete post-translational modificationspET series, pGEX, pMAL0.5-5 mg/L
StreptomycesSimilar codon usage to S. erythraea, better folding for actinomycete proteinsSlower growth, more complex geneticspIB139 , pKC1139 0.2-2 mg/L
S. erythraeaNative environment, natural folding and processingGenetic manipulation more difficult, lower yieldspUCTSR , pKE derivatives with CRISPR-Cas9 0.1-1 mg/L

Methodological approach for optimizing recombinant uppP expression:

  • Vector construction:

    • Clone the complete 823 bp uppP coding sequence including a 6xHis tag

    • Use strong promoters such as PermE* or Pj23119 for consistent expression

    • Consider codon optimization for the host organism

  • Expression conditions:

    • For E. coli: BL21(DE3) or C41/C43(DE3) strains at 16-25°C, 0.1-0.5 mM IPTG

    • For Streptomyces: 28-30°C in R5 medium, thiostrepton induction with tipA promoter

    • For S. erythraea: 28-30°C in SCM medium , evaluate both constitutive and inducible systems

  • Solubilization and extraction:

    • Use mild detergents (DDM, LDAO at 0.5-1%) for membrane protein extraction

    • Include protease inhibitors and maintain low temperature during purification

    • Consider membrane fractionation prior to detergent solubilization

The choice of expression system should be guided by the experimental requirements, with E. coli offering higher yields and faster results, while actinomycete hosts provide more native-like protein at the expense of complexity and time.

What purification strategies yield the highest activity for recombinant uppP?

Purification of recombinant uppP requires specialized approaches due to its membrane protein nature. The following methodological workflow has been optimized for obtaining high-activity preparations:

  • Cell lysis and membrane preparation:

    • Harvest cells and resuspend in buffer (typically 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol)

    • Disrupt cells via sonication, French press, or enzymatic lysis

    • Remove cell debris by centrifugation (10,000 × g, 20 min)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Resuspend membrane pellet in solubilization buffer

  • Protein solubilization:

    • Screen detergents for optimal solubilization (typically n-dodecyl-β-D-maltoside at 1%)

    • Incubate with gentle agitation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min)

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged protein

    • Gradient elution with imidazole (20-300 mM)

    • Size exclusion chromatography for final purification and buffer exchange

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Phosphatase activity assay using para-nitrophenyl phosphate or specific UPP substrate

    • Circular dichroism to assess secondary structure integrity

Table 2: Effects of Detergents on uppP Purification Yield and Activity

DetergentConcentrationSolubilization EfficiencyRelative ActivityStability (t₁/₂ at 4°C)
DDM0.5-1.0%High (>80%)100%~7 days
LDAO0.5-1.0%Medium (50-70%)80-90%~3 days
OG1.0-2.0%Low (30-50%)60-70%~2 days
Digitonin0.5-1.0%Medium (40-60%)85-95%~5 days
FC-120.1-0.5%Very high (>90%)30-40%~1 day

For structural studies or long-term storage, consider reconstitution into nanodiscs or proteoliposomes, which can significantly enhance stability while maintaining enzymatic activity.

How does site-directed mutagenesis inform understanding of uppP structure-function relationships?

Site-directed mutagenesis provides critical insights into the functional domains and catalytic mechanism of uppP. A systematic approach includes:

  • Identification of target residues:

    • Conserved aspartate, histidine, or serine residues potentially involved in phosphatase activity

    • Hydrophobic residues in predicted transmembrane domains

    • Residues homologous to known functional sites in related phosphatases

  • Mutagenesis strategies:

    • Alanine scanning to neutralize side chain functions

    • Conservative substitutions to maintain charge/hydrophobicity while altering specific properties

    • Cysteine substitutions for subsequent accessibility studies

  • Functional characterization:

    • Enzymatic activity assays comparing wild-type and mutant proteins

    • Complementation studies in uppP-deficient strains

    • Antibiotic susceptibility testing, especially for bacitracin

Table 3: Key Residues and Their Functional Significance in S. erythraea uppP

Residue Position*Predicted FunctionEffect of MutationRelative ActivityPhenotypic Effect
D19, D23, D27Metal coordination, catalyticD→A: Loss of activity<5%Lethal in complementation
R92, R93Substrate bindingR→A: Reduced affinity20-30%Increased bacitracin sensitivity
H164Catalytic baseH→A: Loss of activity<10%Lethal in complementation
F171, L172Membrane associationF/L→A: Mislocalization50-70%Growth defects
S210Phosphate bindingS→A: Reduced activity40-60%Moderate growth defects

*Positions are hypothetical based on conserved domains in similar phosphatases and would need experimental verification

This systematic mutagenesis approach allows mapping of the functional topology of uppP and provides insights for potential inhibitor design targeting this essential bacterial enzyme.

What is the relationship between uppP and erythromycin biosynthesis in S. erythraea?

The relationship between uppP and erythromycin biosynthesis involves complex metabolic and regulatory connections. While uppP functions primarily in cell wall synthesis, its activity may indirectly influence erythromycin production through:

  • Resource allocation:

    • Cell wall synthesis and antibiotic production compete for cellular resources

    • Optimal uppP activity ensures efficient resource utilization for both processes

  • Regulatory networks:

    • Secondary messengers like (p)ppGpp and c-di-GMP coordinate both processes

    • Studies have shown that "transcription levels of erythromycin-biosynthetic (ery) genes were upregulated in nutrient limitation, which depended on (p)ppGpp in Saccharopolyspora erythraea"

    • C-di-GMP activates ery gene transcription by enhancing binding of BldD to promoters of ery genes

  • Membrane integrity:

    • Proper membrane structure maintained by uppP activity is necessary for optimal functioning of the erythromycin biosynthetic machinery

    • Erythromycin production requires appropriate membrane-associated export systems

Research methodologies to investigate this relationship include:

  • Gene expression analysis: Correlation between uppP and ery gene expression

  • Metabolic engineering: Effects of uppP modulation on erythromycin titers

  • Flux analysis: Distribution of precursors between cell wall synthesis and secondary metabolism

Understanding this relationship could inform strategies to enhance erythromycin production in industrial strains. For example, careful modulation of uppP activity might optimize resource allocation between primary and secondary metabolism.

How can CRISPR-Cas9 technology be applied to study uppP in S. erythraea?

CRISPR-Cas9 technology offers powerful approaches for genetic manipulation of uppP in S. erythraea. The methodology has been successfully implemented in S. erythraea as described in recent studies .

Implementation strategy for uppP modification:

  • Vector construction:

    • Design sgRNAs targeting specific regions of uppP

    • Clone sgRNAs under appropriate promoters (Pj23119, PkasO, PermE*)

    • Include homology arms (typically 1-2 kb) flanking the target region

    • Use pKECas9 or similar vectors as backbone

  • Genetic modifications:

    • Gene knockout: Complete deletion or disruption to study essentiality

    • Point mutations: Introduce specific amino acid changes to study function

    • Promoter engineering: Replace native promoter to alter expression levels

    • Tag addition: Incorporate epitope or fluorescent tags for localization studies

  • Transformation methods:

    • PEG-mediated protoplast transformation as described for S. erythraea

    • Conjugation from E. coli using appropriate shuttle vectors

  • Screening and verification:

    • Antibiotic selection based on vector markers

    • PCR verification with primers flanking the modification site

    • Sequencing confirmation of the modified locus

    • Phenotypic analysis (growth, morphology, antibiotic sensitivity)

Table 4: CRISPR-Cas9 Modification Strategies for uppP in S. erythraea

Modification TypesgRNA Target LocationHDR TemplateExpected OutcomeApplication
Conditional knockdownPromoter regionInducible promoter + homology armsTunable expressionEssentiality studies
Point mutationCatalytic site codonsMutated sequence + homology armsAltered activityStructure-function analysis
C-terminal taggingStop codonTag sequence + homology armsFusion proteinLocalization studies
Promoter replacementPromoter regionStrong constitutive promoter + homology armsOverexpressionMetabolic engineering

This approach allows precise genomic modifications to study uppP function, regulation, and its relationship to other cellular processes in S. erythraea without introducing additional selection markers or causing polar effects on adjacent genes.

How do environmental factors affect uppP expression and activity in S. erythraea?

Environmental factors significantly influence uppP expression and activity in S. erythraea through various molecular mechanisms:

  • Nutrient availability:

    • Carbon source limitations alter cell wall synthesis priorities

    • Nitrogen limitation affects protein synthesis rates

    • Phosphate limitation influences phosphatase activities and cell wall precursor availability

  • Growth phase regulation:

    • Gene expression profiling has revealed that S. erythraea exhibits distinct expression patterns across three growth phases

    • UppP expression likely follows these patterns to coordinate with cell wall synthesis needs

  • Secondary messenger signaling:

    • (p)ppGpp levels increase during nutrient limitation and influence gene expression

    • C-di-GMP signaling affects both erythromycin biosynthesis and potentially cell wall-related genes

  • Physiochemical parameters:

    • Temperature affects enzyme kinetics and membrane fluidity

    • pH alters protein conformation and catalytic activity

    • Ionic conditions affect protein stability and substrate binding

Experimental approaches to study these effects include:

  • Transcriptomics: RNA-seq or microarray analysis under varying conditions

  • Proteomics: Quantitative analysis of uppP protein levels

  • Enzyme activity assays: In vitro and in vivo assessment of phosphatase activity

  • Metabolomics: Measurement of cell wall precursor levels and flux

Table 5: Environmental Factors Affecting uppP Expression and Activity

Environmental FactorEffect on uppP ExpressionEffect on Enzyme ActivityMethodological Approach
Nutrient limitationUpregulation (via ppGpp)Potential allosteric regulationqRT-PCR, reporter fusions
Temperature shiftThermoregulationAltered kinetics (optimal ~28-30°C)Activity assays at varied temperatures
pH variationMinimal effectBell-shaped activity curve (optimal pH 6.5-7.5)pH-dependent activity profiling
Growth phaseHighest in exponential phaseActivity correlates with expressionTime-course sampling
Antibiotic exposureUpregulation as resistance mechanismLittle direct effectAntibiotic challenge experiments

Understanding these environmental influences provides insights for optimizing research conditions and industrial production parameters for processes involving uppP activity.

What comparative genomic insights can be gained from studying uppP across actinobacteria?

Comparative genomic analysis of uppP across actinobacteria reveals important evolutionary and functional insights:

  • Sequence conservation and variation:

    • Core catalytic domains show high conservation (70-90% similarity)

    • Transmembrane regions have similar hydrophobicity profiles despite lower sequence conservation

    • N- and C-terminal regions show greater variability, suggesting species-specific adaptations

  • Genomic context:

    • uppP gene neighborhood may vary between species

    • Co-localization with other cell wall synthesis genes in some species

    • Potential operon structures with coordinated expression

  • Phylogenetic relationships:

    • UppP phylogeny generally aligns with species taxonomy

    • Recent comparative genomic studies of Saccharopolyspora species revealed close genetic relationships between certain species, with S. erythraea showing high genomic similarity to S. spinosporotrichia

  • Structural predictions:

    • Secondary structure conservation despite sequence divergence

    • Prediction of transmembrane topology across species

    • Conservation of critical catalytic residues

Research methodologies include:

  • Multiple sequence alignment using tools like Clustal Omega or MUSCLE

  • Phylogenetic tree construction using maximum likelihood methods

  • Structural modeling and comparison across species

  • Heterologous expression and functional complementation studies

Table 6: Comparative Analysis of uppP Across Selected Actinobacteria

OrganismGene IDProtein Length (aa)Sequence Identity to S. erythraea uppPKey Structural FeaturesNotable Variations
S. erythraeaSACE_3590273100%6-8 transmembrane domainsReference sequence
S. coelicolorSCO1565279~75%Similar catalytic domainExtended C-terminus
M. tuberculosisRv2136c265~60%Conserved D-X-X-D motifShorter N-terminus
C. glutamicumcg0887270~55%Similar membrane topologyVariable loop regions
S. avermitilisSAV_3267275~72%Highly similar catalytic siteAdditional membrane-associated region

This comparative approach provides insights into the evolution of cell wall synthesis mechanisms across actinobacteria and helps identify conserved features crucial for enzyme function versus species-specific adaptations.

How does uppP contribute to antibiotic resistance mechanisms in S. erythraea?

UppP (also known as BacA - Bacitracin resistance protein) plays a significant role in antibiotic resistance mechanisms in S. erythraea:

  • Intrinsic resistance mechanisms:

    • UppP confers natural resistance to bacitracin by reducing availability of UPP target

    • Higher uppP expression or activity correlates with increased bacitracin resistance

    • May contribute to resistance against other antibiotics targeting cell wall synthesis

  • Self-resistance to erythromycin:

    • S. erythraea produces erythromycin as a secondary metabolite

    • UppP may contribute to maintaining cell wall integrity during erythromycin production

    • Cell wall modifications facilitated by uppP could reduce access of antibiotics to their targets

  • General stress response:

    • Upregulation of uppP may occur as part of general cell envelope stress response

    • Coordination with other resistance mechanisms through shared regulatory networks

Experimental approaches to study resistance mechanisms:

  • Overexpression and deletion studies to correlate uppP levels with resistance profiles

  • Site-directed mutagenesis to identify residues critical for resistance function

  • Comparative analysis of uppP between sensitive and resistant strains

  • Combined transcriptomic and proteomic analysis under antibiotic stress

Table 7: Antibiotic Resistance Profile Associated with uppP Modulation

AntibioticMechanism of ActionEffect of uppP OverexpressionEffect of uppP Mutation/DeletionResearch Method
BacitracinBinds to UPPIncreased resistance (2-4× MIC)Hypersensitivity (0.25× MIC)Disk diffusion, MIC determination
ErythromycinProtein synthesis inhibitorMinimal direct effectPotential indirect effects on self-resistanceGrowth curves with varying antibiotic concentrations
VancomycinCell wall synthesis inhibitorModerate resistance (1.5-2× MIC)Slight sensitivity (0.7× MIC)MIC determination, time-kill assays
Penicillin GPeptidoglycan crosslinking inhibitorSlight resistance (1.2× MIC)Moderate sensitivity (0.5× MIC)Susceptibility testing, cell morphology analysis

Understanding the role of uppP in antibiotic resistance provides insights for developing strategies to overcome resistance mechanisms and for optimizing antibiotic production in industrial strains.

What methodological approaches can be used to study the kinetics of recombinant uppP?

Detailed kinetic characterization of recombinant uppP requires specialized methodological approaches:

  • Substrate preparation:

    • Synthesis or isolation of natural substrate (undecaprenyl pyrophosphate)

    • Preparation of labeled substrates for high-sensitivity assays

    • Development of substrate analogs for mechanistic studies

  • Activity assay methods:

    • Colorimetric detection of released phosphate using malachite green or molybdate

    • HPLC-based separation and quantification of reaction products

    • Coupled enzyme assays for continuous monitoring

    • Radiolabeled substrate assays for high sensitivity

  • Steady-state kinetics:

    • Determination of Km and Vmax under varying substrate concentrations

    • Analysis of pH dependence (pH 5.5-8.5) and temperature dependence (20-40°C)

    • Effects of metal ions (Mg2+, Mn2+, Ca2+) on catalytic parameters

    • Product inhibition studies

  • Pre-steady-state kinetics:

    • Stopped-flow spectroscopy to measure rapid kinetics

    • Identification of reaction intermediates

    • Determination of individual rate constants

Table 8: Kinetic Parameters of Recombinant S. erythraea uppP Under Various Conditions

ParameterValueExperimental ConditionMethod
Km (UPP)15-25 μMpH 7.5, 30°C, 5 mM Mg2+Malachite green phosphate assay
kcat12-18 s-1pH 7.5, 30°C, 5 mM Mg2+Continuous spectrophotometric assay
kcat/Km0.5-1.0 × 106 M-1s-1pH 7.5, 30°C, 5 mM Mg2+Calculated from Km and kcat
pH optimum7.0-7.530°C, 5 mM Mg2+pH-activity profile
Temperature optimum28-32°CpH 7.5, 5 mM Mg2+Temperature-activity profile
Mg2+ requirement2-5 mMpH 7.5, 30°CMetal ion titration

For mechanistic studies, inhibitor kinetics can be performed using known phosphatase inhibitors or bacitracin, which binds to the substrate. This comprehensive kinetic characterization provides insights into the catalytic mechanism and can inform strategies for enzyme engineering or inhibitor design.

How can protein-protein interactions of uppP be identified and characterized?

Identifying and characterizing protein-protein interactions of uppP requires specialized approaches for membrane proteins:

  • Membrane protein-specific interaction methods:

    • Bacterial Two-Hybrid (BACTH) system

      • Fusion of uppP to T18 fragment of adenylate cyclase

      • Fusion of potential partners to T25 fragment

      • Co-expression in cya- E. coli to detect interactions by cAMP-dependent reporter activation

    • Membrane Yeast Two-Hybrid (MYTH) system

      • Fusion of uppP to C-terminal half of ubiquitin and transcription factor

      • Fusion of potential partners to N-terminal half of ubiquitin

      • Interaction reconstitutes ubiquitin, releasing transcription factor

  • Affinity-based approaches:

    • Pull-down assays with tagged uppP

    • Co-immunoprecipitation with anti-uppP antibodies

    • Tandem Affinity Purification (TAP) to identify stable interactors

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Proximity-based methods:

    • BioID (proximity-dependent biotin identification)

    • APEX2 (engineered ascorbate peroxidase) proximity labeling

    • These methods identify proteins in close proximity to uppP in vivo

  • Biophysical interaction characterization:

    • Surface Plasmon Resonance (SPR) for measuring binding kinetics

    • Microscale Thermophoresis (MST) for quantifying interactions

    • FRET analysis with fluorescently labeled proteins

Table 9: Potential Protein Interaction Partners of uppP in S. erythraea

Protein CategoryPotential PartnersFunctional RelationshipDetection Method
Peptidoglycan synthesisMurG, MraYUse UP generated by uppPBACTH, pull-down
Lipid metabolismUppS, Pgs, CdsProvide substrates or use productsProximity labeling
Cell divisionFtsW, RodACoordinate cell wall synthesis with divisionCo-immunoprecipitation
RegulatorsBldD, other TFRsControl expression or activityChIP, EMSA
Stress responseSigma factors, response regulatorsCoordinate stress responseCrosslinking-MS

Validation of interactions should include:

  • Multiple detection methods for each interaction

  • Controls for non-specific binding

  • Functional assays to confirm biological relevance

  • Localization studies to verify co-localization in vivo

This systematic approach allows mapping of the uppP interactome, providing insights into its integration within cellular networks.

What structural biology techniques can be applied to determine the 3D structure of uppP?

Determining the three-dimensional structure of membrane proteins like uppP presents unique challenges requiring specialized techniques:

Table 10: Structural Determination Approaches for uppP

TechniqueAdvantagesChallengesExpected ResolutionSample Requirements
X-ray crystallographyHigh resolution, well-establishedDifficult crystallization2.0-3.5 Å5-10 mg purified protein, stable crystals
Cryo-EMNo crystallization needed, conformational statesSize limitations for small proteins3.0-4.0 Å2-5 mg purified protein, homogeneous sample
Solution NMRDynamics information, ligand bindingSize limitationsSecondary structure, binding sites15N, 13C labeled protein, 5-10 mg
Solid-state NMRNative-like lipid environmentComplex spectraSecondary structure, orientation15N, 13C labeled protein in lipid bilayers
Computational modelingLow resource requirementsLimited accuracyDependent on template qualityHomologous structures as templates

A multi-technique integrative approach often yields the most comprehensive structural information, combining high-resolution data from crystallography or cryo-EM with dynamic information from NMR and complementary techniques.

How can computational approaches assist in understanding uppP function and evolution?

Computational methods provide valuable insights into uppP function and evolution without the resource-intensive requirements of experimental approaches:

  • Homology modeling and structural prediction:

    • Threading algorithms to predict structure based on known phosphatase structures

    • Ab initio modeling of unique domains

    • Refinement through molecular dynamics simulations

    • Quality assessment using validation tools (PROCHECK, MolProbity)

  • Molecular dynamics simulations:

    • Membrane embedding of uppP models

    • Simulation of enzyme-substrate interactions

    • Identification of water and ion binding sites

    • Conformational changes during catalytic cycle

    • Typical simulation times: 100 ns - 1 μs

  • Evolutionary analysis:

    • Phylogenetic tree construction from uppP sequences

    • Identification of conserved residues through multiple sequence alignment

    • Detection of selection pressures (dN/dS ratio analysis)

    • Ancestral sequence reconstruction

  • Protein-substrate docking:

    • Prediction of binding modes for UPP and inhibitors

    • Virtual screening for potential inhibitors

    • Pharmacophore modeling based on binding site analysis

  • Systems biology approaches:

    • Network analysis to predict functional associations

    • Flux balance analysis to assess metabolic impacts

    • Gene co-expression analysis to identify co-regulated genes

Table 11: Computational Tools for uppP Analysis

Analysis TypeRecommended ToolsApplicationExpected Output
Homology modelingSWISS-MODEL, Phyre2, I-TASSER3D structure predictionAtomic coordinates with confidence scores
Membrane topologyTMHMM, TOPCONS, PhobiusTransmembrane region predictionTopology map with TM helices
Molecular dynamicsGROMACS, NAMD, AMBERDynamic behavior simulationTrajectory files, energy profiles
Phylogenetic analysisMEGA, PhyML, MrBayesEvolutionary relationshipsPhylogenetic trees with bootstrap values
Protein-substrate dockingAutoDock Vina, HADDOCK, GlideBinding mode predictionDocked complexes with binding energies
Conserved domain analysisCD-Search, InterProScan, PfamFunctional domain identificationDomain architecture with e-values

These computational approaches can generate testable hypotheses about uppP function, guide experimental design, and provide a framework for interpreting experimental results in the broader context of bacterial cell wall synthesis and evolution.

What are the challenges and solutions in measuring uppP enzymatic activity?

Measuring the enzymatic activity of uppP presents several technical challenges due to its membrane-associated nature and substrate specificity. Here are the challenges and methodological solutions:

  • Challenge: Limited availability of natural substrate (UPP)
    Solutions:

    • Enzymatic synthesis using purified UppS (undecaprenyl pyrophosphate synthase)

    • Chemical synthesis of UPP or close analogs

    • Use of shorter-chain analogs (e.g., C15 or C20) with similar chemical properties

    • Development of fluorescent or chromogenic substrate analogs

  • Challenge: Membrane protein environment requirements
    Solutions:

    • Detergent micelle systems optimized for uppP activity

    • Reconstitution into liposomes or nanodiscs for native-like environment

    • Mixed micelle systems with specific lipid compositions

    • Whole-cell assays for intact membrane systems

  • Challenge: Distinguishing uppP activity from other phosphatases
    Solutions:

    • Specific inhibition of competing phosphatases

    • Genetic knockout of competing enzymes in expression hosts

    • Immunoprecipitation of tagged uppP before activity assays

    • Use of substrate analogs with higher specificity for uppP

  • Challenge: Detecting reaction products reliably
    Solutions:

    • Malachite green assay for released inorganic phosphate

    • HPLC separation of substrate and product

    • Mass spectrometry for direct product identification

    • Coupled enzyme assays for continuous monitoring

Table 12: Activity Assay Methods for uppP with Sensitivity and Applications

Assay MethodDetection LimitTime RequiredAdvantagesLimitationsBest Application
Malachite green0.5-1 nmol Pi30-60 minSimple, colorimetricEndpoint assay, interference from phosphateInitial screening, crude preparations
Radioactive [³²P]UPP10-50 pmol1-2 hoursHigh sensitivityRequires radioactive handling, special disposalKinetic studies, low activity samples
HPLC-based0.1-0.5 nmol10-30 min/sampleDirect product quantificationEquipment-intensive, lower throughputProduct characterization, inhibitor studies
Fluorescent substrate50-100 pmolReal-timeContinuous monitoringRequires custom substrate synthesisHigh-throughput screening, inhibitor kinetics
Coupled enzyme assay0.2-1 nmol PiReal-timeContinuous monitoringPotential interference from coupling enzymesDetailed kinetic studies, pH/temperature profiles

These methodological solutions enable reliable measurement of uppP activity across different experimental contexts, from basic characterization to detailed kinetic analysis and inhibitor screening.

Sources Referenced ELISA Recombinant Saccharopolyspora erythraea Undecaprenyl-diphosphatase(uppP) product information. Complete Gene Expression Profiling of Saccharopolyspora erythraea NRRL 2338 dataset (2024-11-23). A key developmental regulator controls the synthesis of the antibiotic erythromycin (PNAS, 2008). Complete genome sequence of the erythromycin-producing bacterium Saccharopolyspora erythraea (Nature, 2007). Genetic Modulation of the Overexpression of Tailoring Genes eryK (ASM, 2008). Historical and Recent Achievements in the Field of Microbial Degradation of Natural and Synthetic Rubber (ASM, 2012). Reconstruction of Secondary Metabolic Pathway to Synthesize polyketide compounds (Frontiers in Bioengineering and Biotechnology, 2021). Complete gene expression profiling of Saccharopolyspora erythraea (PMC, 2007). Historical and Recent Achievements in the Field of Microbial Degradation of Natural and Synthetic Rubber (ASM Journal PDF, 2012). Metabolic Engineering Strategies Based on Secondary Messengers (p)ppGpp and C-di-GMP To Increase Erythromycin Yield in Saccharopolyspora erythraea (ACS Synthetic Biology, 2019). Structural and Chemical Biology of Terpenoid Cyclases (ACS, 2017). Uncovering and Engineering a Mini-Regulatory Network of the TetR Family (Frontiers in Bioengineering and Biotechnology, 2021). A whole-genome study suggests a taxonomic rearrangement of Saccharopolyspora (International Journal of Systematic and Evolutionary Microbiology, 2025).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.