Recombinant Saccharopolyspora erythraea UPF0060 membrane protein SACE_5620 (SACE_5620)

Shipped with Ice Packs
In Stock

Description

General Information

SACE_5620 is a membrane protein found in Saccharopolyspora erythraea . Membrane proteins are essential for various cellular processes, including nutrient transport, bioenergetic processes, and cell adhesion .

Saccharopolyspora erythraea and Erythromycin Production

Saccharopolyspora erythraea is a filamentous bacterium used industrially to produce erythromycin, a crucial polyketide antibiotic . Erythromycin and its semi-synthetic derivatives, such as azithromycin and clarithromycin, are frequently used to treat Gram-positive pathogen infections .

Role of Membrane Proteins

Membrane proteins, such as SACE_5620, are crucial components in various biological processes . Research emphasizes the significance of membrane proteins in understanding cellular functions and interactions .

Membrane Washing and Protein Identification

Methods like membrane washing with urea or alkaline solutions can significantly enhance the identification of membrane proteins .

Efficacy of Membrane Washing

Sample TypeIdentified ProteinsIdentified Peptides
No Wash273514,307
Urea Wash276214,936
Alkaline Wash244011,607

Urea and alkaline washes increase the identification of transmembrane domain (TMD) proteins .

SACE_5599 and Erythromycin Production

SACE_5599, another regulatory protein in S. erythraea, influences erythromycin production and morphological differentiation, suggesting a close link between secondary metabolite biosynthesis and morphological development .

Regulatory Mechanisms and Erythromycin Biosynthesis

The Lrp and MarR transcriptional regulators in prokaryotes play a role in erythromycin biosynthesis. SACE_Lrp indirectly represses erythromycin biosynthesis, while MarR directly regulates erythromycin biosynthesis and export . Joint engineering of SACE_Lrp and MarR can enhance erythromycin production .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SACE_5620; UPF0060 membrane protein SACE_5620
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Target Names
SACE_5620
Target Protein Sequence
MLVILRSVVLFVLAAVAEIGGAWLVWQGVREQRGLLWIGAGVIALGIYGFVATFQPDPNF GRILAAYGGVFVAGSLLWGVVVDGFRPDRWDLIGATICLAGVAVIMYAPR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SACE_5620 and what is its significance in Saccharopolyspora erythraea?

SACE_5620 is an integral membrane protein belonging to the UPF0060 family, encoded in the genome of Saccharopolyspora erythraea strain NRRL 23338. This protein consists of 110 amino acids and likely contains multiple transmembrane domains based on its hydrophobic sequence profile . While its specific function remains to be fully characterized, it belongs to a conserved protein family found across various bacterial species. S. erythraea is industrially significant as the producer of erythromycin, a clinically important antibiotic, and understanding all components of its cellular machinery (including membrane proteins) may contribute to optimizing antibiotic production .

How does SACE_5620 compare to other UPF0060 membrane proteins across bacterial species?

Comparison of SACE_5620 with other UPF0060 family members reveals significant sequence conservation:

ProteinOrganismSequence SimilarityNotable DifferencesReference
MMAR_2961Mycobacterium marinumHighC-terminal region variations
Rv2639c/Mt2717Mycobacterium tuberculosisModerateAdditional hydrophilic regions
ynfAEscherichia coliModerateDifferent transmembrane organization
OCAR_5428Oligotropha carboxidovoransModerateVariant loop regions

What purification strategies are most effective for SACE_5620?

Effective purification of SACE_5620 typically follows this workflow:

  • Expression with affinity tag: N-terminal 10xHis tag is commonly used for SACE_5620 .

  • Membrane extraction: Cells are lysed, and membranes isolated through differential centrifugation.

  • Detergent solubilization: Critical step using mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) to extract the protein from membranes.

  • Affinity chromatography: His-tagged protein is captured using Ni-NTA or TALON resin.

  • Size exclusion chromatography: Final purification step to obtain homogeneous protein.

For structural studies, the vesicle-based approach may be preferable to detergent solubilization as it preserves the native lipid environment and protein conformation . This involves isolating membrane vesicles containing the overexpressed protein rather than extracting it with detergents.

What detergent considerations are important when working with SACE_5620?

When working with SACE_5620 or other membrane proteins, detergent selection is critical:

Detergent TypeAdvantagesLimitationsApplications
DDMMild, maintains protein stabilityLarge micellesStructural studies
LMNGVery mild, low CMCExpensiveCryo-EM studies
DigitoninPreserves protein complexesLimited solubilityNative complex isolation

What structural characterization approaches are suitable for SACE_5620?

Several complementary methods can be employed for structural characterization of SACE_5620:

  • X-ray crystallography: Challenging for membrane proteins but provides atomic resolution. Requires detergent screening and crystal optimization.

  • Cryo-electron microscopy: Increasingly popular for membrane proteins, particularly:

    • Single-particle analysis for purified protein

    • Vesicle-based approaches which maintain the native lipid environment

  • NMR spectroscopy: Suitable for smaller membrane proteins or domains, providing dynamic information.

  • Computational modeling: Homology modeling based on related structures, particularly from UPF0060 family members .

  • Hydrogen-deuterium exchange mass spectrometry: Provides information on protein dynamics and solvent accessibility.

The vesicle-based method described by researchers avoids detergent solubilization entirely, potentially preserving native structure: "This method presents a promising approach for studying structure and function of membrane protein in their native environment without the need for detergent screening and protein purification" .

How might SACE_5620 relate to erythromycin biosynthesis in S. erythraea?

While direct evidence linking SACE_5620 to erythromycin biosynthesis is limited, several hypotheses can be explored:

  • Membrane transport: SACE_5620 might function in transport of erythromycin precursors or export of the final product.

  • Regulatory network involvement: Similar to the identified TetR-family regulators (TFRs) like SACE_0303, SACE_5620 could participate in regulatory networks affecting erythromycin production .

  • Cellular homeostasis maintenance: By analogy with other bacterial membrane proteins, SACE_5620 may contribute to membrane integrity or ion homeostasis critical for optimal antibiotic production.

Research approaches to investigate these hypotheses include:

  • Deletion or overexpression of SACE_5620 followed by measurement of erythromycin production

  • Transcriptomic and proteomic profiling to identify co-regulated genes

  • CRISPR/Cas9-based manipulation as demonstrated for other S. erythraea genes

What experimental approaches can be used to study protein-protein interactions involving SACE_5620?

Several complementary techniques can be employed to identify and characterize SACE_5620 interaction partners:

  • Co-immunoprecipitation: Using antibodies against tagged SACE_5620 to pull down interaction partners.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking captures transient interactions, followed by MS identification.

  • FRET/BRET assays: For monitoring interactions in living cells using fluorescent protein fusions.

  • Bacterial two-hybrid systems: Adapted for membrane protein interactions.

  • High-speed atomic force microscopy: As demonstrated for other membrane proteins, this can directly visualize protein-protein interactions in membrane environments .

  • Vesicle-based reconstitution: Allows controlled study of interactions between SACE_5620 and other membrane or soluble proteins in a native-like membrane environment .

For membrane proteins like SACE_5620, techniques that preserve the membrane environment are particularly valuable, as demonstrated in studies showing that "membrane proteins form oligomers and supramolecular assemblies" with interaction energies of several kBT within a radius of ~50 Å in the membrane plane .

How can functional reconstitution of SACE_5620 be achieved for biophysical studies?

Successful functional reconstitution of SACE_5620 can be achieved through these approaches:

  • Proteoliposome preparation:

    • Purified SACE_5620 is mixed with lipids (typically PC:PG at 7:3 ratio) and detergent

    • Detergent removal via dialysis, Bio-Beads, or cyclodextrin

    • Resulting proteoliposomes can be used for functional assays

  • Giant Unilamellar Vesicle (GUV) reconstitution:

    • For microscopy-based studies

    • Two approaches are viable:
      a) Direct GUV formation from proteoliposomes
      b) Fusion of protein-containing small unilamellar vesicles (SUVs) with preformed GUVs

  • Fusion-based reconstitution:

    • "Using fusion of oppositely charged membranes to reconstitute a model membrane protein"

    • Particularly valuable when different membrane proteins require incompatible reconstitution conditions

  • Nanodisc assembly:

    • Membrane scaffold protein-based systems for single-protein studies

    • More homogeneous than liposomes, suitable for structural studies

What genetic manipulation approaches can be applied to study SACE_5620 function in vivo?

Several genetic approaches can be employed to investigate SACE_5620 function in S. erythraea:

These approaches can be combined with phenotypic analysis, particularly assessing impact on erythromycin production using HPLC analysis methods similar to those used in regulatory network studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.