Recombinant Saccharum hybrid Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; PS136; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Saccharum hybrid (Sugarcane)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGTKSNNTVYNATSTGIVK KILRKEKGGYEISIVDASDGRQVIDIIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
Recombinant Saccharum hybrid Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic context of Saccharum hybrid from which Apocytochrome f is derived?

Saccharum hybrid cultivars are complex derivatives from interspecific hybridization between Saccharum officinarum and Saccharum spontaneum, containing the full complement of S. officinarum chromosomes and a smaller number of S. spontaneum chromosomes and recombinants . This genomic complexity presents unique challenges for genetic studies:

  • Hybrid sugarcane genomes are allo-autopolyploid with variable ploidy levels

  • Chromosome numbers range from 100 to 130

  • Genome size is approximately 10 Gb, with each chromosome having 8-12 copies of homologous genes

  • The monoploid sugarcane genome is estimated to be 382 Mb in size

Modern sugarcane cultivars typically share more transcripts with S. officinarum than with S. spontaneum, reflecting the genomic contribution pattern, while the progenitor species themselves share relatively few transcripts .

How is Recombinant Saccharum hybrid Apocytochrome f (petA) produced in laboratory settings?

The production of recombinant Apocytochrome f typically follows this methodology:

  • Expression system selection: E. coli is the preferred expression system due to high yield and established protocols .

  • Vector construction:

    • The mature protein sequence (amino acids 36-320) is used

    • An N-terminal His-tag is added for purification purposes

    • The construct is cloned into an appropriate expression vector

  • Expression conditions:

    • Induction method: Typically IPTG for T7 promoter-based systems

    • Culture optimization: Temperature, media composition, and induction time require optimization

    • Collection: Cells are harvested by centrifugation and lysed by sonication or mechanical disruption

  • Purification process:

    • Affinity chromatography using Ni-NTA or similar matrices due to His-tag

    • Further purification by ion exchange or size exclusion chromatography if higher purity is required

    • Buffer exchange to remove imidazole and other contaminants

  • Final preparation:

    • Lyophilized powder form or stabilized in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For storage, 5-50% glycerol (typically 50%) is recommended

What are the optimal storage and handling conditions for this recombinant protein?

Based on established protocols for recombinant proteins from plant sources:

  • Short-term storage:

    • Working aliquots should be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can cause denaturation

  • Long-term storage:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary to avoid repeated freeze-thaw cycles

    • Lyophilized powder generally has a shelf life of 12 months at -20°C/-80°C

    • Liquid formulations have a shelf life of approximately 6 months at -20°C/-80°C

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Default recommended glycerol concentration is 50%

  • Buffer conditions:

    • Typical storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

How can researchers use Apocytochrome f to study photosynthetic differences between Saccharum species and their hybrids?

Apocytochrome f serves as a valuable tool for comparative photosynthetic studies between Saccharum species and their hybrids due to several factors:

  • Transcriptomic comparison methodology:

    • Long-read sequencing technology (such as PacBio) can be used to sequence the full-length transcripts without assembly artifacts

    • Map the hybrid's Apocytochrome f transcript variants against both progenitor species

    • Analyze sequence variations, expression levels, and post-transcriptional modifications

  • Genomic contribution analysis:

    • Create alignment maps using bioinformatics tools (such as CLC Genomics Workbench)

    • Use varying mapping stringency (0.8-1.0 length and similarity fractions)

    • Determine which progenitor species contributed the petA gene variants in the hybrid

  • Functional implications:

    • Sugar-related transcripts typically originate from S. officinarum

    • Stress and senescence-related transcripts generally come from S. spontaneum

    • The hybrid may express novel variants or unique combinations of variants from both progenitors

  • Experimental design considerations:

    • Include both leaf and stem tissues for comprehensive analysis

    • Pool RNA in equimolar ratios for representative sampling

    • Use proper controls from both parental species for comparative analysis

What insights can Apocytochrome f provide into hybrid sugarcane genetics and breeding programs?

Studying Apocytochrome f in hybrid sugarcane provides valuable insights for breeding programs:

  • Genetic diversity assessment:

    • Analyze the diversity of petA gene variants to understand genetic heterogeneity

    • In F1 hybrid populations, traits typically show:

      • Shannon-Wiener diversity index (H′) between 2.64-2.98

      • Broad-sense heritability of 0.75-0.84 for most traits

  • Correlation with agronomic traits:

    • Photosynthetic efficiency correlates with sucrose yield (SY)

    • F1 hybrid populations show significant variation in key traits:

    TraitRangeMean ± SDCVSkewnessH′Heritability
    Stalk height (M)2.10-4.313.16 ± 0.360.120.302.960.83
    Brix (%)16.54-30.3120.87 ± 1.820.091.162.860.80
    Sucrose content (%)10.20-18.7114.89 ± 1.970.131.162.860.80
    Sucrose yield (T/ha)2.10-21.7511.55 ± 4.060.350.122.980.80

    Data adapted from F1 hybrid population studies

  • Applications in marker-assisted selection:

    • Development of species-specific markers for the petA gene

    • Identification of advantageous alleles from both progenitor species

    • Selection of hybrids with optimal combination of traits

  • Photosynthetic efficiency improvement strategies:

    • Target petA gene variants associated with higher photosynthetic rates

    • Select for specific Apocytochrome f isoforms correlated with increased sucrose yield

    • Develop breeding strategies that optimize electron transport chain efficiency

What NIH Guidelines apply to research involving Recombinant Saccharum hybrid proteins?

Research involving recombinant Saccharum hybrid proteins is subject to NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, with the following key considerations:

  • Definition and applicability:

    • Recombinant nucleic acid molecules are defined as "molecules that a) are constructed by joining nucleic acid molecules and b) can replicate in a living cell"

    • Synthetic nucleic acids are defined as "nucleic acid molecules that are chemically or by other means synthesized or amplified, including those that are chemically or otherwise modified but can base pair with naturally occurring nucleic acid molecules"

  • Exemption criteria:

    • The recombinant protein itself is exempt from NIH Guidelines, as only the nucleic acids used to produce it are regulated

    • According to the NIH Office of Science Policy: "proteins produced by genetically engineered organisms are not subject to the NIH Guidelines"

  • Compliance requirements for production methods:

    • If producing the recombinant protein in-house, the expression system (e.g., E. coli) and vector must comply with NIH Guidelines

    • Standard E. coli K-12 host-vector systems may be exempt under Appendix C of the NIH Guidelines

    • Research must be registered with the Institutional Biosafety Committee (IBC) if not exempt

  • Documentation practices:

    • Maintain detailed records of the recombinant DNA constructs used

    • Document risk assessment and containment procedures

    • Keep records of IBC approval or exemption determination

How do different research applications of Recombinant Saccharum hybrid Apocytochrome f impact regulatory requirements?

Different applications of the recombinant protein have varying regulatory implications:

  • Basic research applications:

    • Standard laboratory research with the purified protein has minimal regulatory requirements

    • Once the protein is purified, it is not subject to the NIH Guidelines

  • In vivo experimental applications:

    • Introduction of the recombinant protein into organisms may require additional approvals

    • Animal studies may require IACUC approval in addition to any recombinant DNA considerations

  • Clinical or translational research:

    • Human gene transfer experiments are subject to Section III-C of the NIH Guidelines

    • Clinical applications require IBC approval and all applicable regulatory authorizations

    • RAC review may be required for novel applications that present unknown risks

  • International research considerations:

    • Research conducted abroad with NIH funding must comply with NIH Guidelines

    • If the host country has established rules for recombinant research, those rules must also be followed

    • In the absence of host country rules, research must be reviewed by an NIH-approved IBC and accepted by an appropriate national governmental authority

What are common challenges in working with Recombinant Saccharum hybrid Apocytochrome f and how can they be addressed?

Researchers frequently encounter several challenges when working with this recombinant protein:

  • Protein solubility issues:

    • Challenge: Apocytochrome f is a membrane-associated protein that may have limited solubility

    • Solution: Use appropriate detergents or solubilizing agents during purification

    • Recommended approach: Test multiple buffer conditions with varying pH (7.0-8.5) and salt concentrations (100-500 mM NaCl)

  • Activity verification:

    • Challenge: Confirming that the recombinant protein retains native activity

    • Solution: Develop functional assays specific to electron transport capabilities

    • Methodology: Measure redox potential or electron transfer rates using standard biochemical techniques

  • Structural integrity assessment:

    • Challenge: Ensuring proper folding of the recombinant protein

    • Solution: Employ circular dichroism (CD) spectroscopy to assess secondary structure

    • Alternative: Use limited proteolysis to compare digestion patterns with native protein

  • Stability during storage:

    • Challenge: Maintaining activity during long-term storage

    • Solution: Follow recommended storage conditions with glycerol and trehalose as stabilizers

    • Best practice: Create multiple small aliquots to minimize freeze-thaw cycles

How can researchers validate the authenticity and functionality of commercially obtained Recombinant Saccharum hybrid Apocytochrome f?

When working with commercially obtained recombinant protein, validation is critical:

  • Purity assessment:

    • Run SDS-PAGE to confirm >90% purity as specified in product descriptions

    • Consider Western blot analysis using anti-His tag antibodies or specific anti-Apocytochrome f antibodies

  • Sequence verification:

    • Compare the provided amino acid sequence with the reference sequence (UniProt ID: Q6L387)

    • If necessary, perform peptide mass fingerprinting to confirm protein identity

  • Functional validation:

    • Design assays relevant to the protein's role in electron transport

    • Compare activity to other well-characterized cytochrome proteins

    • Consider using spectroscopic methods to assess heme incorporation and redox properties

  • Species-specificity confirmation:

    • If studying species-specific variations, perform comparative analysis with other plant cytochrome f proteins

    • Analyze key residues that differ between Saccharum hybrid and other species like Spinacia oleracea (spinach)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.