Recombinant Saccharum hybrid ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

Subunit a (atpI) is integral to the F<sub>O</sub> sector’s rotary mechanism:

  • Proton Translocation: Collaborates with the c-subunit ring (c<sub>10</sub>–c<sub>14</sub>) to drive rotation via H<sup>+</sup> gradient .

  • Structural Stabilization: Anchors the c-ring to prevent ion leakage and maintain coupling efficiency .

  • Na<sup>+</sup> Specificity: In related archaeal ATP synthases, subunit a homologs enable Na<sup>+</sup>-dependent activity, suggesting evolutionary conservation of ion selectivity .

3.1. Cooperativity in c-Subunit Rotation

Studies on Bacillus PS3 ATP synthase revealed that mutations in adjacent c-subunits (e.g., cE56D) reduce ATP synthesis efficiency. This highlights functional coupling between subunit a and the c-ring, where proton transfer kinetics depend on cooperative interactions .

3.3. Role in Thermodynamic Efficiency

Chloroplast ATP synthases operate near thermodynamic limits (Δψ ≈ 90–150 mV). Subunit a’s proton channel geometry optimizes energy transduction, enabling ATP synthesis even at low membrane potentials .

Applications in Research

  1. Mechanistic Studies: Used to dissect proton-driven rotation in plant ATP synthases .

  2. Bioengineering: Template for modifying ion specificity (e.g., H<sup>+</sup> vs. Na<sup>+</sup>) to enhance crop photosynthetic efficiency .

  3. Drug Development: Screening platform for ATP synthase inhibitors targeting F<sub>O</sub> sector dysfunction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development according to your request.
Synonyms
atpI; PS110; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
atpI
Target Protein Sequence
MNITPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.