Recombinant Saccharum hybrid Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharum Hybrid cemA

The cemA protein is a chloroplast-encoded, highly hydrophobic integral membrane protein localized to the chloroplast envelope . In Saccharum hybrids (sugarcane), recombinant cemA is produced via heterologous expression systems (e.g., E. coli) for functional studies and industrial applications . The recombinant form typically includes partial sequences (e.g., MBS7089885) , retaining critical transmembrane domains and functional motifs.

Primary and Secondary Structure

  • Sequence: Partial sequence data for recombinant Saccharum hybrid cemA are proprietary, but homologs in related species (e.g., Barbarea verna, Nephroselmis olivacea) reveal a conserved structure with 4–6 transmembrane α-helices .

  • Domains: Contains a chloroplast transit peptide and maturation site for envelope targeting .

FeatureSaccharum Hybrid cemA (Partial)Barbarea verna cemANephroselmis olivacea cemA
Length (aa)Partial (exact length unspecified)229392
Transmembrane Domains4–6 predicted65
Molecular Weight (kDa)~34 (estimated)~25.9~44.3
Expression SystemE. coli (MyBioSource) E. coli E. coli

Post-Translational Modifications

  • Purified via His-tag affinity chromatography .

  • Stable in Tris/PBS buffers with trehalose for long-term storage .

Biological Functions

  • Ion Transport: Facilitates proton extrusion and inorganic carbon uptake into chloroplasts, critical for photosynthesis .

  • Stress Response: Upregulated under abiotic stress (e.g., salinity, drought) and phytohormone treatments (e.g., MeJA, SA) .

  • Transcriptional Regulation: Co-transcribed with atpA, psbI, and atpH in polycistronic mRNA clusters .

Biotechnological Applications

  • Protein Production Platforms: Saccharum hybrids are engineered to express recombinant proteins (e.g., lectins, enzymes) at high yields .

  • Therapeutic Development: Used as a carrier molecule for antiviral and antitumor therapies due to its stability and binding specificity .

Expression and Purification

  • Recombinant cemA accumulates up to 2.3% of total soluble protein (TSP) in sugarcane culms under stacked promoter systems .

  • Affinity purification yields functional protein with >90% purity (SDS-PAGE) .

Functional Studies

  • Gene Knockouts: Deletion of cemA in Chlamydomonas disrupts polycistronic transcript processing, reducing ATP synthase subunit III (atpH) expression .

  • Subcellular Localization: Confirmed in chloroplast envelope inner membranes via immunoassays .

Comparative Analysis of cemA Homologs

ParameterSaccharum HybridChlamydomonas reinhardtiiArabidopsis thaliana
Genomic ContextatpA-psbI-cemA-atpH atpA-cemA clusterSingle-gene locus
TranscriptsPolycistronic MonocistronicMonocistronic
Stress InductionABA, MeJA Not reportedCa²⁺ signaling

Challenges and Future Directions

  • Sequence Gaps: Full-length Saccharum hybrid cemA sequence remains undisclosed, limiting mechanistic studies .

  • Functional Validation: Role in carbon-concentrating mechanisms requires further in planta assays .

  • Industrial Scaling: Optimizing sugarcane bioreactors for high-yield cemA production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are happy to prioritize your specific tag type requirement. Please inform us of your preference, and we will strive to develop the specified tag.
Synonyms
cemA; PS135; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
cemA
Target Protein Sequence
MKKKKALPSFLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETFLTDIQEKRILEGF IELEELFLLDEMIKEKPKTHVQKLPIGIHKEIIQLAKIDNEDHLHIILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELLIRWVYNN LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the chloroplast envelope membrane protein (cemA) and what role does it play in Saccharum hybrids?

    The chloroplast envelope membrane protein (cemA) is an integral component of the two-membrane system surrounding plastids in Saccharum hybrids (sugarcane). As part of the chloroplast envelope, cemA contributes to the essential transport activities that integrate chloroplast metabolism within the plant cell. Chloroplast envelope proteins facilitate specific metabolite exchange and signaling processes between the chloroplast and the cytosol. The envelope serves as a critical interface for numerous transport activities, though only a limited number of proteins involved in transport across the chloroplast envelope have been fully characterized at the molecular level . In Saccharum hybrids, cemA may have specialized functions related to sugarcane metabolism and photosynthetic efficiency.

  • How do researchers effectively isolate and characterize the cemA protein from Saccharum hybrid chloroplasts?

    Effective isolation and characterization of cemA protein from Saccharum hybrid chloroplasts requires a combined approach of subcellular fractionation and proteomic analysis. The recommended methodology involves:

    1. Isolation of highly purified chloroplast membrane fractions

    2. Extraction of hydrophobic proteins using organic solvents to capture membrane-embedded proteins like cemA

    3. Separation by SDS/PAGE

    4. Identification through tandem mass spectrometry analysis

    For processing MS/MS data, specialized blast-based programs are essential when searching protein, expressed sequence tag, and genomic plant databases . This approach has proven successful in identifying envelope proteins with multiple α-helical transmembrane regions characteristic of membrane transporters. When working with recombinant cemA, researchers can leverage established protocols for isolating hydrophobic membrane proteins while adapting them to the specific characteristics of Saccharum hybrid cellular components.

  • What genetic diversity exists among Saccharum hybrids, and how might this impact cemA protein studies?

    Significant genetic diversity exists among Saccharum hybrids, which has direct implications for cemA protein studies. Research on 129 sugarcane clones revealed considerable genetic variation when analyzed through multivariate methods using the Mahalanobis distance (D²ᵢᵢ'). Environmental factors significantly influence this diversity, as demonstrated by studies conducted in different locations (Paranavaí and Campo Mourão), which clustered the same clones into 10 and 19 groups respectively .

    This genetic diversity impacts cemA research in several ways:

    • Protein sequence variations may exist across different sugarcane cultivars

    • Expression levels of cemA may differ between genotypes

    • Functional properties of cemA could vary among different Saccharum hybrids

    • Experimental design must account for genotype-specific responses

    Researchers should carefully select representative genotypes when studying cemA or consider multiple genotypes to capture the potential functional diversity of this protein across the Saccharum genus.

Methodological Considerations

  • What extraction and purification protocols maximize yield and purity of recombinant cemA protein while maintaining its native conformation?

    Extracting and purifying recombinant cemA protein while preserving its native conformation requires careful consideration of its membrane-bound nature. Optimal protocols should include:

    1. Membrane isolation: Differential centrifugation followed by sucrose gradient purification to obtain enriched chloroplast envelope fractions

    2. Solubilization: Testing a panel of detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, or CHAPS) at varying concentrations to identify optimal solubilization conditions that maintain protein structure

    3. Affinity purification: Utilizing fusion tags (e.g., His-tag, FLAG-tag) positioned to minimize interference with protein folding, preferably at the N or C terminus if these regions are predicted to be cytosolic

    4. Size exclusion chromatography: To separate properly folded protein from aggregates and remove detergent micelles

    5. Reconstitution: Incorporation into liposomes or nanodiscs composed of lipids mimicking the chloroplast envelope membrane composition

    Throughout the process, maintaining proper pH (typically pH 7.0-8.0), ionic strength, and temperature (4°C) is essential to prevent protein denaturation. Additionally, including protease inhibitors and performing all steps rapidly helps minimize degradation .

  • How should researchers validate the functionality of recombinant cemA protein after expression and purification?

    Validating the functionality of recombinant cemA protein after expression and purification is crucial to ensure that the protein maintains its native properties. A comprehensive validation approach should include:

    1. Structural integrity assessment:

      • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

      • Size exclusion chromatography to verify proper oligomeric state

      • Limited proteolysis to assess proper folding

    2. Membrane integration:

      • Flotation assays with liposomes to confirm membrane association

      • Protease protection assays to verify correct topology

    3. Functional assays:

      • Transport assays if cemA is involved in metabolite transport

      • Binding assays for interaction partners

      • Complementation studies in cemA-deficient systems

    4. Comparative analysis:

      • Compare properties with native cemA isolated from Saccharum chloroplasts

      • Assess post-translational modifications where relevant

    Given the genomic stability observed in tissue culture regenerants of sugarcane , researchers can develop cemA-modified plant lines as controls for validating recombinant protein functionality in physiologically relevant contexts.

  • What regulatory considerations apply to research involving recombinant cemA protein, and how should experiments be designed to ensure compliance?

    Research involving recombinant cemA protein must adhere to regulatory frameworks governing recombinant DNA technology. Key considerations include:

    1. NIH Guidelines compliance:
      The NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules apply to research with nucleic acid molecules created by synthetic means, effective March 5, 2013 . These guidelines define recombinant and synthetic nucleic acid molecules and establish safety practices for their use.

    2. Institutional Biosafety Committee (IBC) approval:
      Research protocols involving recombinant cemA should be reviewed and approved by the institutional IBC prior to initiation.

    3. Containment measures:
      Appropriate physical and biological containment measures should be implemented based on the risk assessment of the specific research activities.

    4. Experimental design considerations:

      • Use well-characterized expression systems with established safety records

      • Implement appropriate containment for the risk group of the host organism

      • Consider potential ecological impacts if expressing recombinant cemA in plants

      • Document all cloning strategies, vector constructs, and expression methods

    5. Material transfer:
      Ensure proper documentation and permissions when transferring recombinant materials between institutions .

    Researchers should consult with their institutional biosafety officers early in the project planning phase to ensure all regulatory requirements are addressed before commencing experimental work with recombinant cemA.

  • How can genetic analysis techniques be optimized to detect variations in cemA across different Saccharum hybrid genotypes?

    Optimizing genetic analysis techniques to detect variations in cemA across different Saccharum hybrid genotypes requires specialized approaches due to the complex polyploid nature of sugarcane. Recommended techniques include:

    1. DNA extraction and amplification:

      • Use high-quality DNA extraction methods optimized for plants with high polysaccharide content

      • Design primers in conserved regions flanking cemA to ensure consistent amplification across genotypes

      • Consider long-range PCR techniques for capturing the complete cemA gene and regulatory regions

    2. Restriction fragment length polymorphism (RFLP) analysis:

      • Digest total DNA with appropriate restriction enzymes (EcoRI, HindIII, BamHI, PstI)

      • Probe with cemA-specific sequences to identify polymorphisms

      • This approach has successfully detected genomic variations in sugarcane cultivars

    3. Next-generation sequencing approaches:

      • Targeted sequencing of the cemA region across multiple genotypes

      • RNA-seq to compare cemA expression levels between genotypes

      • Whole genome sequencing with specific analysis of the chloroplast genome

    4. Analysis methods:

      • Apply multivariate statistical analyses such as Canonical Variables and Tocher method using Mahalanobis distance

      • These methods have effectively characterized genetic diversity in sugarcane clones

    5. Validation:

      • Confirm sequence variations through Sanger sequencing

      • Assess functional implications of detected variations through protein expression and activity assays

    This comprehensive approach enables researchers to characterize cemA diversity across the spectrum of Saccharum hybrids, providing valuable insights into the molecular evolution and functional adaptation of this chloroplast envelope protein.

Research Applications and Future Directions

  • How might understanding cemA function contribute to improving photosynthetic efficiency in sugarcane?

    Understanding cemA function could significantly contribute to improving photosynthetic efficiency in sugarcane through several potential mechanisms:

    1. Optimized metabolite transport:
      If cemA functions as a transporter in the chloroplast envelope, enhancing its activity could improve the exchange of metabolites between the chloroplast and cytosol, potentially reducing bottlenecks in photosynthetic pathways.

    2. Enhanced stress tolerance:
      Chloroplast envelope proteins often play roles in stress response. Modifying cemA expression or activity could potentially enhance photosynthetic performance under suboptimal conditions such as drought, heat, or high light stress.

    3. Improved carbon fixation:
      By better understanding cemA's role in chloroplast function, researchers may identify ways to enhance carbon fixation efficiency, potentially through improved CO₂ concentration mechanisms or metabolite shuttling.

    4. Engineering opportunities:
      The genetic stability observed in tissue culture regenerants of sugarcane suggests that genetic engineering approaches targeting cemA could be stable across generations, making it a viable target for crop improvement.

    5. Genotype-specific optimization:
      Given the genetic diversity among sugarcane clones , identifying optimal cemA variants from different genotypes could inform breeding programs or guide genetic modification strategies aimed at improving photosynthetic performance.

    Research in this direction could contribute to developing more resource-efficient sugarcane varieties with increased biomass production and sugar yield, addressing global challenges in food security and bioenergy production.

  • What are the most promising computational approaches for predicting cemA protein structure and interactions in the absence of crystallographic data?

    In the absence of crystallographic data, several computational approaches show promise for predicting cemA protein structure and interactions:

    1. AlphaFold and RoseTTAFold:
      These AI-based protein structure prediction tools have revolutionized the field by accurately predicting structures of proteins with limited sequence homology to known structures. They can be particularly valuable for membrane proteins like cemA where experimental structures are challenging to obtain.

    2. Membrane protein-specific modeling:
      Tools optimized for membrane protein topology prediction (TMHMM, TOPCONS) can be used to identify transmembrane regions of cemA, followed by specialized membrane protein modeling.

    3. Molecular dynamics simulations:
      Once a preliminary structure is predicted, MD simulations in a lipid bilayer environment can refine the model and provide insights into dynamic behaviors and conformational changes.

    4. Protein-protein docking:
      Programs like HADDOCK or ClusPro can predict interactions between cemA and other chloroplast proteins identified through experimental approaches.

    5. Coevolutionary analysis:
      Methods leveraging evolutionary coupling (such as GREMLIN or EVcouplings) can identify residues that have coevolved, suggesting structural contacts or functional importance.

    6. Integration with experimental data:
      Computational predictions can be constrained and validated using limited experimental data such as crosslinking results, antibody epitope mapping, or mutagenesis studies.

    These approaches align with the methodology that has successfully identified common features among envelope inner membrane transporters, enabling the establishment of virtual plastid envelope integral protein databases . By combining multiple computational methods and integrating available experimental data, researchers can develop increasingly accurate models of cemA structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.