Recombinant Saccharum hybrid NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; PS126; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILVFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic origin of ndhC in commercial Saccharum hybrids?

The ndhC gene in commercial sugarcane hybrids reflects their complex hybrid nature, with genetic material primarily derived from S. officinarum and S. spontaneum. Historical records and molecular evidence indicate that modern commercial hybrids share remarkable similarities with S. officinarum accessions from New Guinea, supporting the hypothesis that a small number of plants from this region were used to generate all modern commercial cultivars . Long-read transcriptome sequencing confirms that modern hybrids share a larger number of transcripts with S. officinarum (approximately 75%) than with S. spontaneum (approximately 68.7%), reflecting their genomic contribution patterns . This genetic architecture affects the expression and function of chloroplastic genes including ndhC.

How does polyploidy affect ndhC characterization in Saccharum hybrids?

Polyploidy presents significant challenges for ndhC characterization in Saccharum hybrids. Commercial sugarcane varieties contain the full complement of S. officinarum chromosomes plus a few S. spontaneum chromosomes and recombinants . This complex genomic structure results in:

  • Multiple homeologous copies of ndhC with varying sequence composition

  • Differential expression patterns from different genomic origins

  • Challenges in assembly of short-read sequencing data due to high sequence similarity

  • Potential chimeric assemblies that do not represent real transcripts

Researchers must employ long-read sequencing technologies that can capture full-length transcripts without the need for assembly to accurately characterize ndhC variants in these hybrids .

What is the relationship between ndhC and photosynthetic efficiency in Saccharum?

The ndhC protein functions as a critical component of the NAD(P)H dehydrogenase (NDH) complex in chloroplasts, which participates in cyclic electron flow around photosystem I. In Saccharum hybrids, which are known for high photosynthetic efficiency, the NDH complex contributes to:

  • ATP production without net NADPH oxidation

  • Enhanced electron transport under stress conditions

  • Protection against photoinhibition

  • Maintenance of optimal redox balance in the chloroplast

The genetic contribution of S. officinarum provides sugar-related transcripts, while S. spontaneum contributes stress-related genes . This unique combination potentially enables sugarcane hybrids to maintain photosynthetic efficiency under diverse environmental conditions.

What sequencing approaches are most effective for studying ndhC in polyploid Saccharum hybrids?

For accurate characterization of ndhC in highly polyploid Saccharum hybrids, researchers should employ:

Sequencing ApproachAdvantagesLimitationsApplication to ndhC
PacBio HiFiGenerates high-quality long reads (2-4kb); captures full-length transcriptsHigher cost per baseIdeal for distinguishing homeologous ndhC copies
Oxford NanoporeLongest read lengths; real-time sequencingHigher error rateUseful for structural variant detection
Illumina short-readHigh accuracy; cost-effectiveCannot span repetitive regionsUseful for quantitative expression studies
RNA-seqReveals expression patternsAssembly challengesRequires careful mapping protocols for homeolog discrimination

PacBio sequencing has successfully generated high-quality, full-length transcript sequences for Saccharum hybrids and their progenitor species, with clustered high-quality reads ranging from 49,908 to 119,662 depending on the genotype .

How can researchers isolate and functionally characterize recombinant ndhC protein?

Isolation and characterization of recombinant ndhC require:

  • Gene Cloning Strategy:

    • Design primers based on conserved regions across homeologs

    • Clone from cDNA libraries derived from photosynthetically active tissues

    • Consider codon optimization for the expression system

  • Protein Expression System:

    • Express with fusion tags (His, GST) to facilitate purification

    • Optimize expression conditions (temperature, induction time)

    • Consider membrane protein expression systems for this integral membrane protein

  • Functional Characterization:

    • In vitro reconstitution with other NDH complex components

    • Electron transport assays using artificial electron acceptors

    • Reconstitution in liposomes for membrane-associated activity measurements

  • Structural Analysis:

    • Antibody development against specific epitopes, similar to approaches used for NdhH

    • Circular dichroism to assess secondary structure

    • Protein-protein interaction studies with other NDH complex subunits

How do researchers distinguish between homeologous copies of ndhC in experimentation?

Distinguishing between homeologous copies requires sophisticated approaches:

  • Sequence-Based Discrimination:

    • Allele-specific PCR targeting unique SNPs

    • Long-read sequencing to capture full-length variants

    • TRAP (Target Region Amplification Polymorphism) markers, which have shown polymorphism information content (PIC) values of approximately 0.25-0.26 in Saccharum hybrids

  • Expression Analysis:

    • Variant-specific RT-qPCR

    • RNA-seq with homeolog-specific mapping parameters

    • Single-cell RNA-seq to identify cell-type specific expression patterns

  • Protein-Level Discrimination:

    • Mass spectrometry to identify variant-specific peptides

    • Variant-specific antibodies if epitope differences exist

    • 2D electrophoresis to separate protein variants based on charge/mass differences

How does genetic diversity of ndhC vary across different Saccharum hybrid cultivars?

Genetic diversity analysis of ndhC should consider:

  • The divergence between progenitor species (S. officinarum and S. spontaneum diverged approximately 580-780 thousand years ago)

  • The breeding history of commercial hybrids, which often share maternal ancestry from New Guinea S. officinarum

  • Introgression events during hybrid formation and commercial breeding

When analyzing Saccharum hybrids, researchers typically observe:

  • Higher sequence similarity among commercial hybrids sharing recent ancestry

  • Greater divergence in cultivars that incorporate diverse germplasm from wild relatives

  • Potential structural variations influenced by the ratio of S. officinarum to S. spontaneum chromosomes

What molecular markers are most useful for studying ndhC genetic diversity?

Based on research practices with Saccharum hybrids, effective molecular marker approaches include:

Marker TypeApplicationEffectivenessExample Metrics
SSRGenetic diversity assessmentHigh polymorphism informationAverage PIC: 0.26, Ho: 0.28, He: 0.28
TRAPFunctional diversity analysisTarget gene-specific polymorphismAverage PIC: 0.25, Ho: 0.24, He: 0.25
SNP panelsHigh-throughput genotypingGood for complex polyploidsCan detect haplotype distribution patterns
Chloroplast markersMaternal lineage trackingUseful for hybrid origin studiesSupports New Guinea origin of commercial hybrids

These marker systems have successfully differentiated Brazilian and Argentinean sugarcane genotypes, revealing population structure that reflects breeding program differences .

How has the evolution of ndhC contributed to adaptive traits in modern Saccharum hybrids?

The evolutionary history of ndhC has likely contributed to adaptive traits through:

  • Progenitor Specialization:

    • S. spontaneum variants evolved for stress tolerance across diverse environments

    • S. officinarum variants optimized for high photosynthetic efficiency under cultivation

  • Hybrid Combination Effects:

    • Modern hybrids contain unique combinations of ndhC variants that may contribute to:

      • Enhanced cyclic electron flow under drought conditions

      • Improved photosynthetic efficiency under varying light conditions

      • Better stress tolerance while maintaining high productivity

  • Selection During Breeding:

    • Commercial breeding programs likely indirectly selected for beneficial ndhC variants while selecting for yield and stress tolerance

    • Different breeding programs show distinct genetic structures, suggesting program-specific selection pressure

What methods are most effective for analyzing ndhC function in photosynthetic electron transport?

To analyze ndhC function in photosynthetic electron transport, researchers should consider:

  • Physiological Measurements:

    • Chlorophyll fluorescence to assess cyclic electron flow

    • P700 redox kinetics to evaluate PSI cyclic electron transport

    • Gas exchange measurements under varying light and CO₂ conditions

  • Biochemical Approaches:

    • Thylakoid membrane isolation and in vitro electron transport assays

    • Blue-native gel electrophoresis to assess NDH complex assembly

    • Activity staining to evaluate enzyme function

  • Genetic Modification Strategies:

    • RNA interference for partial knockdown

    • CRISPR-Cas9 gene editing (challenging in polyploids)

    • Overexpression of wild-type or modified variants

  • Comparative Analysis:

    • Cross-species comparisons with related grasses like Sorghum bicolor

    • Comparison between hybrid and progenitor species responses

How does ndhC expression differ between Saccharum hybrids and their progenitor species?

Transcriptome analyses reveal:

  • Expression Pattern Differences:

    • Modern hybrids show expression profiles intermediate between progenitors or novel patterns not present in either parent

    • The hybrid typically has a higher number of transcripts related to energy metabolism than either progenitor species

  • Tissue-Specific Patterns:

    • Expression may be tissue-specific, with some tissues showing more similarity to S. officinarum and others to S. spontaneum

    • Sugar-related gene expression patterns typically follow S. officinarum, while stress-related gene expression often shows S. spontaneum patterns

  • Regulatory Differences:

    • Transcription factors and regulatory elements may differ between progenitors

    • The hybrid contains unique combinations of regulatory elements affecting ndhC expression

What is the relationship between ndhC and stress tolerance in Saccharum hybrids?

The relationship includes:

  • Drought Response:

    • Enhanced cyclic electron flow mediated by the NDH complex helps maintain ATP production when CO₂ assimilation is limited by stomatal closure

    • S. spontaneum contributions to the hybrid genome likely enhance this function, as this species contributes stress and senescence-related transcripts

  • High Light Protection:

    • The NDH complex helps dissipate excess excitation energy under high light conditions

    • This protection mechanism is particularly important in tropical and subtropical sugarcane growing regions

  • Temperature Stress Adaptation:

    • NDH-mediated cyclic electron flow adjusts to temperature fluctuations

    • Modern hybrids benefit from adaptations present in both progenitor species

How can CRISPR-Cas9 gene editing be optimized for targeting ndhC in polyploid Saccharum hybrids?

CRISPR-Cas9 optimization for ndhC editing must address:

  • Guide RNA Design Challenges:

    • Identification of conserved target regions across homeologs for complete knockout

    • Design of homeolog-specific guides for targeted editing

    • Prediction and minimization of off-target effects in the complex genome

  • Delivery Methods:

    • Optimization of transformation protocols for sugarcane tissue

    • Selection of appropriate promoters for Cas9 and guide RNA expression

    • Temporal control of expression to minimize somatic mutations

  • Screening Strategies:

    • Development of sensitive screening methods to detect editing events in polyploid backgrounds

    • Deep sequencing to quantify editing efficiency across all homeologs

    • Phenotypic screening under stress conditions to identify functional impacts

  • Efficiency Considerations:

    • The complex polyploid nature of Saccharum hybrids makes complete gene knockout challenging

    • Partial editing may result in dosage effects rather than complete loss-of-function

How can multi-omics approaches enhance our understanding of ndhC function?

Integrated approaches should include:

  • Combined Transcriptomics, Proteomics, and Metabolomics:

    • Long-read transcriptomics to identify all ndhC variants expressed

    • Proteomics to quantify protein abundance and post-translational modifications

    • Metabolomics to assess impacts on photosynthetic metabolism

  • Comparative Analyses:

    • Comparison across Saccharum hybrids and progenitor species

    • Analysis under varying environmental conditions

    • Developmental time series to capture temporal regulation

  • Integration with Physiological Data:

    • Correlation of molecular data with photosynthetic performance

    • Mapping of stress responses to molecular changes

    • Identification of key regulatory nodes affecting ndhC function

  • Network Analysis:

    • Construction of gene co-expression networks to identify genes regulated with ndhC

    • Protein-protein interaction networks to map the NDH complex interactome

    • Metabolic flux analysis to quantify impacts on carbon metabolism

What are the implications of ndhC research for improving Saccharum hybrid performance?

Research implications include:

  • Breeding Applications:

    • Identification of beneficial ndhC variants for marker-assisted selection

    • Potential genetic engineering of optimized ndhC variants

    • Development of screening tools for photosynthetic efficiency

  • Environmental Adaptation:

    • Enhancement of stress tolerance, particularly for drought and high temperature

    • Improvement of photosynthetic efficiency under suboptimal conditions

    • Extension of cultivation range through enhanced environmental resilience

  • Germplasm Exchange Opportunities:

    • Analysis of diverse germplasm could identify novel beneficial variants

    • Exchange between breeding programs could extend the genetic base of germplasm banks

    • Introduction of new alleles could improve hybrid performance

What spectroscopic techniques are most informative for studying ndhC function?

Key spectroscopic approaches include:

How can researchers differentiate between ndhC-dependent and independent cyclic electron flow pathways?

Differentiation requires:

  • Inhibitor Studies:

    • Use of specific inhibitors: rotenone (inhibits NDH complex) versus antimycin A (inhibits PGR5/PGRL1 pathway)

    • Measurement of residual activity following inhibitor application

  • Genetic Approaches:

    • Comparison of wild-type plants with ndhC-impaired lines

    • Complementation studies with variant forms of ndhC

  • Physiological Measurements:

    • Assessment of redox kinetics of electron carriers under different conditions

    • Measurement of proton gradient formation with specific inhibitors

    • Analysis of response to changing CO₂ concentrations, which differentially affects pathways

  • Biochemical Separation:

    • Isolation of different complexes involved in cyclic electron flow

    • Activity measurements of isolated complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.