Recombinant Saccharum hybrid NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

What is the complete amino acid sequence of Saccharum hybrid ndhE protein?

The complete amino acid sequence of the Saccharum hybrid NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is: MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN . This 101-amino acid sequence represents the full-length protein encoded by the ndhE gene located in the chloroplast genome.

What are the key structural domains of the ndhE protein and their predicted functions?

The ndhE protein contains transmembrane domains characteristic of membrane-bound subunits in the NAD(P)H dehydrogenase complex. Based on structural analysis, the protein features hydrophobic regions that anchor it within the thylakoid membrane, with specific domains involved in electron transport within the chloroplast electron transport chain. The N-terminal region (residues 1-25) contains a hydrophobic segment likely serving as a membrane anchor, while the central region coordinates with other NDH complex subunits for electron transfer activities .

What are the optimal conditions for heterologous expression of recombinant ndhE protein?

For optimal heterologous expression of recombinant Saccharum hybrid ndhE protein, an E. coli expression system using BL21(DE3) strain with pET vector systems provides effective results. Expression should be induced with 0.5-1.0 mM IPTG at 16-18°C for 16-18 hours to minimize formation of inclusion bodies and maximize soluble protein yield. Due to the membrane-associated nature of ndhE, addition of mild detergents (0.1-0.5% Triton X-100) to lysis buffers enhances protein extraction. A double-tag purification approach using His-tag and GST-tag systems can significantly improve protein purity and stability for downstream applications .

What methodologies are most effective for analyzing ndhE protein interactions within the NDH complex?

The most effective methodologies for analyzing ndhE protein interactions within the NDH complex include:

• Blue Native PAGE (BN-PAGE): Allows separation of intact protein complexes while preserving protein-protein interactions

• Co-immunoprecipitation (Co-IP): Using antibodies specific to ndhE or other NDH subunits

• Yeast two-hybrid (Y2H): For screening potential interaction partners

• Bimolecular Fluorescence Complementation (BiFC): For visualizing protein interactions in planta

• Crosslinking mass spectrometry: For capturing transient interactions and identifying interaction interfaces

These approaches should be combined with advanced microscopy techniques like FRET (Förster Resonance Energy Transfer) to validate interactions in vivo .

How can researchers effectively design primers for PCR amplification of the ndhE gene from different Saccharum species?

Effective primer design for PCR amplification of the ndhE gene from different Saccharum species requires consideration of sequence conservation across species and attention to chloroplast genome organization. Researchers should:

• Align ndhE sequences from multiple Saccharum hybrids and related species to identify conserved regions

• Design primers with 18-25 nucleotides, 40-60% GC content, and melting temperatures between 55-65°C

• Include restriction enzyme sites with 2-4 base overhangs for directional cloning

• Avoid secondary structures and primer dimers through software analysis (e.g., OligoAnalyzer)

• Consider touchdown PCR protocols to accommodate potential sequence variations among different Saccharum species and hybrids

For difficult templates, addition of DMSO (5-10%) and betaine (1-2 M) can improve amplification efficiency when working with the high GC content typical of Saccharum genomes .

What role does ndhE play in cyclic electron transport in Saccharum hybrid chloroplasts?

The ndhE protein functions as an essential subunit of the chloroplast NDH complex, which facilitates cyclic electron flow around photosystem I. This process is particularly important in C4 plants like Saccharum hybrids, where it:

• Generates additional ATP without NADPH production

• Balances the ATP/NADPH ratio required for carbon fixation processes

• Provides photoprotection under high light conditions by dissipating excess excitation energy

• Enhances photosynthetic efficiency under fluctuating light and environmental stress conditions

Studies suggest that the function of ndhE is especially critical in sugarcane's adaptation to tropical environments with high light intensity, contributing to the plant's photosynthetic efficiency and stress response mechanisms .

How does ndhE expression vary across different tissues and developmental stages in Saccharum hybrids?

Expression analysis of ndhE across different tissues and developmental stages reveals distinctive patterns:

Expression is significantly upregulated under high light conditions and during recovery from photoinhibition, suggesting a role in photoprotection and stress adaptation. The expression pattern also varies seasonally, with higher levels typically observed during periods of active growth and lower levels during dormant phases .

What experimental approaches can determine the impact of ndhE mutations on photosynthetic efficiency?

Several experimental approaches can effectively determine the impact of ndhE mutations on photosynthetic efficiency:

• Chlorophyll Fluorescence Analysis: Measuring parameters such as quantum yield (Φ_PSII), non-photochemical quenching (NPQ), and electron transport rate (ETR) to assess photosystem II performance

• Gas Exchange Measurements: Quantifying CO₂ assimilation rates, stomatal conductance, and transpiration under varying light, CO₂, and temperature conditions

• P700 Absorbance Changes: Monitoring photosystem I activity and cyclic electron flow

• Thylakoid Membrane Isolation: Assessing electron transport rates using artificial electron acceptors/donors

• Comparative Growth Analysis: Evaluating biomass accumulation, leaf area development, and yield components under different environmental conditions

These approaches should be implemented across different developmental stages and under various environmental stresses (drought, high light, temperature extremes) to comprehensively assess the functional significance of ndhE in photosynthetic processes .

How conserved is the ndhE protein sequence across different Saccharum species and their wild relatives?

Analysis of ndhE protein sequence conservation across Saccharum species and wild relatives reveals high conservation patterns within the genus but increasing divergence with evolutionary distance:

This conservation pattern suggests strong selective pressure on ndhE functional domains, particularly those involved in electron transport and protein-protein interactions within the NDH complex. The highest conservation occurs in the central hydrophobic regions essential for membrane integration and electron transfer functions .

What evolutionary insights can be gained from phylogenetic analysis of ndhE sequences across the Saccharum complex?

Phylogenetic analysis of ndhE sequences across the Saccharum complex provides several evolutionary insights:

• The ndhE gene exhibits a slower evolutionary rate compared to nuclear genes, consistent with the generally conservative evolution of chloroplast genomes

• Sequence analysis supports the hybrid origin of commercial sugarcane, with evidence of maternal inheritance from S. officinarum in most commercial varieties

• Comparative analysis with wild relatives shows that the closest relatives to commercial sugarcane based on ndhE sequences are Miscanthidium capense and Miscanthidium junceum, which diverged approximately 3 million years ago

• The evolutionary patterns of ndhE correlate with the adaptation of different Saccharum species to varying environmental conditions, particularly regarding photosynthetic efficiency under different light and temperature regimes

• The conservation patterns of ndhE across species can be used to assess the likelihood of gene flow and hybridization potential between commercial sugarcane and wild relatives, which has implications for biosafety assessments of genetically modified varieties

These insights contribute to our understanding of Saccharum evolution and can guide breeding programs seeking to incorporate beneficial traits from wild relatives .

How can CRISPR-Cas9 technology be optimized for editing the chloroplast-encoded ndhE gene in Saccharum hybrids?

Optimizing CRISPR-Cas9 technology for editing the chloroplast-encoded ndhE gene in Saccharum hybrids requires specialized approaches due to the unique challenges of chloroplast transformation:

• Chloroplast-specific CRISPR-Cas9 systems: Development of specialized vectors with chloroplast transit peptides to target Cas9 to chloroplasts, while ensuring the sgRNA can access the chloroplast genome

• Biolistic delivery methods: Optimization of gold particle size (0.6-1.0 μm), helium pressure (1100-1350 psi), and target tissue selection (young leaf base or embryogenic callus) for maximum transformation efficiency

• Selection markers: Utilization of chloroplast-specific selection markers like spectinomycin or streptomycin resistance genes under the control of chloroplast promoters

• Homology-directed repair templates: Design of templates with extended homology arms (>500 bp) to enhance integration efficiency

• Multiple copy targeting strategies: Implementation of approaches to ensure editing of all copies of the chloroplast genome within a cell, as each chloroplast contains multiple genome copies

The polyploid and aneuploid nature of Saccharum hybrids necessitates careful design of sgRNAs to target conserved regions of ndhE across all chloroplast genome copies, with validation through high-throughput sequencing to confirm complete editing .

What approaches can be used to study post-translational modifications of ndhE and their functional significance?

Several sophisticated approaches can be employed to study post-translational modifications (PTMs) of ndhE and their functional significance:

• Mass Spectrometry-Based Proteomics:

  • Tandem MS/MS analysis with high-resolution instruments (Orbitrap or Q-TOF)

  • Enrichment strategies for specific PTMs (phosphopeptide enrichment with TiO₂ or IMAC)

  • Quantitative approaches (SILAC, TMT labeling) to compare PTM abundance under different conditions

• Site-Directed Mutagenesis:

  • Systematic mutation of potential PTM sites to non-modifiable residues

  • Creation of phosphomimetic mutations (S/T to D/E) to simulate constitutive phosphorylation

  • Complementation studies in knockout/knockdown lines to assess functional significance

• In vitro Enzymatic Assays:

  • Kinase/phosphatase assays with purified ndhE protein

  • Activity measurements before and after enzymatic modification

  • Identification of specific enzymes responsible for modifications

• Structural Biology Approaches:

  • Cryo-EM analysis of NDH complex with and without PTMs

  • Hydrogen-deuterium exchange mass spectrometry to detect structural changes induced by PTMs

These approaches should be integrated with physiological studies under different environmental conditions (high light, drought, temperature stress) to correlate PTM patterns with functional responses and adaptive mechanisms .

How can researchers effectively study the role of ndhE in enhancing abiotic stress tolerance in Saccharum hybrids?

To effectively study ndhE's role in abiotic stress tolerance in Saccharum hybrids, researchers should implement a multi-faceted approach:

• Controlled Environment Studies:

  • Expose plants to precisely defined stress conditions (drought, salinity, temperature extremes, high light)

  • Monitor physiological responses (photosynthetic parameters, ROS production, membrane integrity)

  • Correlate stress responses with ndhE expression and NDH complex activity

• Molecular Genetic Approaches:

  • Generate transgenic lines with altered ndhE expression (overexpression, antisense, RNAi)

  • Create targeted mutations in key functional domains using CRISPR-Cas9

  • Perform complementation studies with ndhE variants from stress-tolerant wild relatives

• Comparative Transcriptomics and Proteomics:

  • Compare expression profiles between stressed and control plants

  • Identify co-expressed genes and interaction networks

  • Analyze protein-protein interactions under stress conditions

• Field Trials and Phenotyping:

  • Evaluate transgenic or edited lines under natural stress conditions

  • Implement high-throughput phenotyping with imaging technologies (chlorophyll fluorescence imaging, thermal imaging, hyperspectral analysis)

  • Assess yield components and agronomic performance

• Metabolic Analysis:

  • Measure changes in energy status (ATP/ADP ratio, NADPH/NADP⁺ ratio)

  • Analyze metabolic adjustments in response to altered ndhE function

  • Determine impacts on carbon assimilation and allocation patterns

This comprehensive approach will provide insights into how ndhE contributes to stress adaptation mechanisms and potential avenues for improving crop resilience through targeted modification of cyclic electron transport pathways .