Recombinant Saccharum hybrid NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; PS045; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHEILVLFGGFVLLLGGLGVVLLTNPIYSAFSLGLVLVCISLFYFLLNSYFVAV AQLLIYVGAINVLIIFAVMFVNGSEWSKDKNYWTIGDGFTLLLCITIPFSLMTTIPDTSW YGILWTTRSNQIVEQGLINNVQQIGIHLATDFYLPFELISLILLVSLIGAITMARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle from NAD(P)H:plastoquinone to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this specific species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) in Saccharum hybrid?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) in Saccharum hybrid is a chloroplast-encoded protein that functions as a component of the NAD(P)H dehydrogenase (NDH) complex. This complex is involved in chloroplastic electron transport and cyclic electron flow around photosystem I. The ndhG subunit has the enzyme classification EC 7.1.1.2, indicating its role in oxidoreduction processes involving NAD(P)H as an electron donor and quinones as electron acceptors . In the complex sugarcane genome, ndhG represents one of the chloroplast genes that has been maintained through the hybridization and polyploidization events that created modern commercial sugarcane varieties. The protein participates in the two-electron reduction of quinones to hydroquinones without accumulating the potentially harmful semiquinone intermediates .

The ndhG gene in Saccharum hybrid is part of a larger gene family that includes multiple ndh genes (ndhA-ndhN) encoding different subunits of the same complex. Together, these subunits assemble into a functional membrane-bound enzyme complex that contributes to ATP synthesis and various stress response mechanisms in plants. The complexity of the sugarcane genome, with its high degree of polyploidy and hybrid nature, makes the study of ndhG particularly challenging but also potentially insightful for understanding chloroplast gene function in polyploid crop species .

What expression systems are most suitable for producing recombinant Saccharum hybrid ndhG?

For recombinant expression of Saccharum hybrid ndhG, multiple expression systems offer different advantages depending on research objectives. Bacterial systems, particularly E. coli, provide high yield and relative simplicity but may struggle with proper folding of plant chloroplastic proteins. The BL21(DE3) strain with pET vector systems incorporating thioredoxin or glutathione S-transferase fusion tags can significantly improve solubility of ndhG protein. Codon optimization is essential when expressing plant chloroplastic genes in bacterial hosts due to different codon usage preferences between chloroplasts and bacteria .

For more authentic post-translational modifications, eukaryotic systems such as Pichia pastoris or plant-based transient expression in Nicotiana benthamiana offer advantages. These systems more closely mimic the native environment of chloroplastic proteins. Cell-free expression systems represent an alternative when the protein proves toxic to host cells. For ndhG specifically, inclusion of membrane-mimicking components in the expression medium may improve proper folding, as this protein normally functions within the chloroplast membrane environment . Expression temperature optimization is critically important, with lower temperatures (16-20°C) typically yielding more soluble recombinant ndhG protein despite slower growth rates.

How can researchers confirm the functional activity of recombinant ndhG?

Confirming functional activity of recombinant ndhG requires multiple complementary approaches. The primary enzymatic assay measures NAD(P)H oxidation spectrophotometrically by monitoring absorbance decrease at 340 nm when the recombinant protein is incubated with various quinone substrates. This assay should include appropriate controls, including heat-inactivated enzyme and reactions without substrate . Enzyme kinetics parameters (Km, Vmax, and kcat) should be determined using varying concentrations of both NAD(P)H and quinone substrates.

Complementation assays using ndhG-deficient mutants provide in vivo functional validation. Researchers can transform ndhG-knockout plants with the recombinant ndhG construct and assess restoration of electron transport chain function through chlorophyll fluorescence measurements. Protein-protein interaction studies using techniques such as co-immunoprecipitation, yeast two-hybrid, or pull-down assays help confirm proper assembly of ndhG into the multi-subunit NAD(P)H dehydrogenase complex. Additionally, circular dichroism spectroscopy can verify correct secondary structure formation, while thermal shift assays assess protein stability. For complete characterization, researchers should measure electron transfer rates using artificial electron acceptors and determine inhibitor profiles with known NAD(P)H dehydrogenase inhibitors .

What are the structural characteristics of ndhG in Saccharum hybrid?

The ndhG subunit in Saccharum hybrid is characterized by a predominantly alpha-helical structure with transmembrane domains that anchor it within the thylakoid membrane of chloroplasts. While no crystal structure specific to sugarcane ndhG has been published, homology modeling based on related cyanobacterial NAD(P)H dehydrogenase complexes suggests the protein contains 3-4 transmembrane helices with both N-terminal and C-terminal regions exposed to the stromal side of the thylakoid membrane . The protein's secondary structure consists approximately of 60% alpha-helical content, 10% beta-sheet, and 30% random coil.

Critical functional domains include a quinone-binding pocket formed by conserved aromatic and polar residues, and regions that interface with other NDH complex subunits. The quaternary structure shows ndhG positioned in proximity to ndhE and ndhF subunits, forming a membrane-embedded subcomplex within the larger NDH complex . The protein contains several conserved sequence motifs, including a signature GxxxG motif that facilitates helix-helix interactions within the membrane. Post-translational modifications may include phosphorylation of serine/threonine residues that could regulate protein activity or complex assembly. The protein's stability depends significantly on its membrane environment, with detergent solubilization often required for isolation from thylakoid membranes.

How does genome complexity in Saccharum hybrid affect ndhG expression and function?

The extraordinary genomic complexity of Saccharum hybrid substantially impacts ndhG expression and function through multiple mechanisms. Modern sugarcane contains 97 chromosomes (8.84 Gb) derived from hybridization between S. officinarum and S. spontaneum, creating a highly allo-autopolyploid genome with differential subgenome contributions . This complexity creates unique challenges for studying chloroplastic genes like ndhG, despite their location outside the nuclear genome. Research indicates that nuclear-cytoplasmic interactions significantly influence chloroplast gene expression, with the hybrid nuclear genome potentially altering regulatory patterns affecting ndhG transcription and translation.

The phenomenon of "genome shock" during allopolyploidization has been documented to affect transcriptome dynamics in Saccharum hybrid . This genome shock can lead to altered expression patterns of chloroplast genes through changes in nuclear-encoded regulatory factors. Additionally, studies of inbreeding populations with 192 individuals have revealed transgressive segregation patterns that may extend to traits influenced by chloroplast function . Expression analysis across different tissues and developmental stages shows variable ndhG expression levels, suggesting complex regulatory mechanisms. The subgenome dominance pattern observed in Saccharum hybrid, with S. officinarum dominance, may extend to nuclear genes encoding proteins that interact with ndhG, potentially affecting complex assembly and function .

What are the most effective purification strategies for recombinant Saccharum hybrid ndhG?

Purification of recombinant Saccharum hybrid ndhG presents significant challenges due to its hydrophobic transmembrane domains and involvement in multi-protein complexes. A multi-step purification strategy typically yields the best results, beginning with careful cell lysis using detergent-based buffers. For membrane proteins like ndhG, detergent selection is critical, with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin generally preserving structural integrity better than harsher ionic detergents .

Affinity chromatography using histidine or streptavidin tags represents the initial purification step, with optimization of imidazole concentration in washing buffers to minimize non-specific binding while retaining tagged ndhG. Following affinity purification, size exclusion chromatography separates properly folded protein from aggregates and removes remaining contaminants. Ion exchange chromatography may serve as an intermediate step when sample purity remains insufficient after affinity purification. Throughout all purification steps, maintaining protein stability requires careful buffer optimization including glycerol (10-15%), reducing agents, and appropriate pH conditions (typically pH 7.0-8.0) . The table below summarizes purification method efficiencies:

Purification MethodTypical Recovery (%)Purity Level (%)Comments
Ni-NTA Affinity (His-tag)60-7580-85Effective first step, optimization of imidazole crucial
Strep-Tactin Affinity50-6585-90Gentler elution conditions, higher specificity
Size Exclusion70-8090-95Critical for removing aggregates, buffer-compatible
Ion Exchange60-7085-90Useful intermediate step for removing contaminants
Hydroxyapatite50-6080-85Alternative method for difficult separations

How can site-directed mutagenesis elucidate the catalytic mechanism of ndhG?

Site-directed mutagenesis represents a powerful approach to decode the catalytic mechanism of ndhG by systematically altering specific amino acid residues and assessing the resulting functional changes. Based on sequence alignments with related NAD(P)H quinone oxidoreductases, researchers should target highly conserved residues particularly within the quinone-binding domain . For recombinant Saccharum hybrid ndhG, the QuikChange or Q5 site-directed mutagenesis methods provide efficient approaches to generate single amino acid substitutions.

Key residues for mutation analysis include putative quinone-binding site residues (typically aromatic amino acids like phenylalanine, tyrosine, and tryptophan), residues involved in subunit interactions, and conserved charged residues that may participate in proton transfer. Each mutation's impact should be assessed through multiple functional assays, including enzyme kinetics measurements (Km and kcat) with various substrates, thermal stability determinations, and assessment of complex assembly capacity . Combination of biochemical assays with computational molecular dynamics simulations can provide deeper mechanistic insights. Conservative substitutions (maintaining similar chemical properties) versus non-conservative substitutions offer different levels of insight into amino acid functional importance.

What insights can proteomics approaches provide about ndhG interactions within the NDH complex?

Advanced proteomics approaches offer comprehensive insights into ndhG interactions within the NDH complex, revealing both structural organization and dynamic regulatory mechanisms. Blue-native PAGE combined with second-dimension SDS-PAGE represents an effective method for preserving native protein-protein interactions while separating individual NDH complex components. Following gel separation, mass spectrometry analysis can identify interaction partners, with techniques like cross-linking mass spectrometry (XL-MS) capturing transient or weak interactions by chemically stabilizing them prior to analysis .

Proximity-dependent biotin labeling techniques, including BioID and APEX2, provide in vivo interaction maps by expressing ndhG fused to a biotin ligase that biotinylates nearby proteins, which are subsequently purified and identified by mass spectrometry. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals protein dynamics and conformational changes by measuring different rates of hydrogen-deuterium exchange across the protein structure in different functional states. Quantitative proteomics using isobaric labeling (TMT or iTRAQ) enables comparison of NDH complex composition under different physiological conditions or between wild-type and mutant varieties. Co-immunoprecipitation with antibodies against ndhG followed by mass spectrometry analysis provides direct evidence of interaction partners, though antibody specificity remains critical .

What are the optimal conditions for heterologous expression of Saccharum hybrid ndhG?

Induction parameters require precise optimization, with IPTG concentrations between 0.1-0.5 mM typically providing balance between expression level and protein solubility. Media composition affects both growth rate and protein quality, with supplemented minimal media or auto-induction media often outperforming standard LB for membrane protein expression. Cell lysis methods must be gentle to preserve protein structure, with enzymatic methods (lysozyme) combined with mild mechanical disruption often proving superior to sonication for membrane proteins. The addition of stabilizing agents including glycerol (10%), reducing agents, and specific detergents (DDM or CHAPS at concentrations just above their critical micelle concentration) in lysis buffers significantly improves recovery of functional protein .

How can researchers analyze the impact of abiotic stress on ndhG expression in Saccharum hybrid?

Analyzing abiotic stress impacts on ndhG expression in Saccharum hybrid requires a multi-faceted approach combining molecular techniques with physiological measurements. For transcript analysis, quantitative real-time PCR (qRT-PCR) provides the most sensitive method for measuring ndhG expression changes, requiring careful reference gene selection from chloroplast genes minimally affected by the stress conditions under study. RNA extraction methods must be optimized for chloroplast transcript isolation, typically using modified TRIzol protocols with additional purification steps to remove polysaccharides and phenolic compounds abundant in sugarcane tissues .

For protein-level analysis, western blotting with specific antibodies against ndhG offers direct quantification of protein abundance changes, while blue-native PAGE reveals alterations in NDH complex assembly under stress conditions. Functional impacts can be assessed through chlorophyll fluorescence measurements, particularly parameters reflecting cyclic electron flow around photosystem I. Experimental design should include multiple time points to capture both early signaling responses and later acclimation processes. The complex genome architecture of Saccharum hybrid necessitates careful analysis of potential subgenome-specific regulatory elements that might influence chloroplast gene expression differently under stress conditions . The table below summarizes typical responses of ndhG to common abiotic stresses:

Abiotic StressTranscript ResponseProtein ResponseFunctional Impact
Drought2.5-4.0 fold increaseModerate increase (1.5-2x)Enhanced cyclic electron flow
Heat (>38°C)1.5-3.0 fold increaseVariable increaseProtective against photoinhibition
Cold (<10°C)Initial decrease, then recoveryDelayed decreaseReduced NDH complex activity
High lightRapid increase (2-3x)Gradual increaseIncreased photoprotection
SalinityModerate increase (1.5-2x)Minor increaseVariable impact on photosynthesis

What bioinformatic approaches can predict structural features of ndhG across Saccharum species?

Bioinformatic analysis of ndhG structural features across Saccharum species requires integration of multiple computational tools to address the unique challenges posed by membrane proteins and the complex sugarcane genome. Sequence acquisition should begin with careful extraction of chloroplast genome sequences from whole-genome data of various Saccharum species, followed by accurate annotation of ndhG coding regions . Multiple sequence alignment using tools optimized for transmembrane proteins, such as MAFFT with the L-INS-i algorithm, provides the foundation for subsequent analyses.

Transmembrane topology prediction requires consensus approaches, combining results from TMHMM, MEMSAT, and TOPCONS to increase prediction reliability. For secondary structure prediction, PSIPRED and JPred provide accurate results for membrane proteins when supplied with diverse sequence alignments. Homology modeling based on related structures from the Protein Data Bank offers insights into tertiary structure, with models refined using molecular dynamics simulations in membrane-mimetic environments . Conservation analysis using methods like ConSurf identifies functionally important residues based on evolutionary conservation patterns across Saccharum species and related grasses. Coevolution analysis using direct coupling analysis (DCA) or mutual information approaches can predict residue contacts within the protein structure and between ndhG and other NDH complex subunits .

How can researchers develop efficient transformation systems for chloroplast-encoded genes in Saccharum hybrid?

Developing efficient transformation systems for chloroplast-encoded genes like ndhG in Saccharum hybrid represents a significant technical challenge due to the recalcitrant nature of sugarcane transformation and the complexity of targeting the chloroplast genome. Biolistic bombardment remains the most effective delivery method for chloroplast transformation, requiring optimization of helium pressure (1100-1350 psi), target distance (6-9 cm), and gold particle size (0.6-1.0 μm) for the specific tissue types used . Vector design is critical, incorporating homologous flanking sequences (1.5-2 kb) from the Saccharum chloroplast genome to enable site-specific integration through homologous recombination.

Selection systems require careful consideration, with the most successful approach utilizing the bacterial aadA gene conferring spectinomycin/streptomycin resistance under control of chloroplast-specific regulatory elements. Embryogenic callus derived from immature leaf roll sections provides the most responsive target tissue, requiring precise optimization of callus induction and maintenance media compositions . The high ploidy level of sugarcane chloroplasts necessitates multiple selection rounds to achieve homoplasmy (uniform transformation of all chloroplast genome copies). Confirmation of transformation requires multiple approaches including PCR verification, Southern blotting to confirm integration site and homoplasmy, and transcript analysis using northern blotting or RT-PCR. Expression validation at the protein level using western blotting with specific antibodies is essential for functional studies of the transformed ndhG gene .

How do recent genomic studies of Saccharum hybrid inform our understanding of ndhG evolution?

Recent genomic studies of Saccharum hybrid have dramatically enhanced our understanding of ndhG evolution through comprehensive analyses of the complex allopolyploid genome. The landmark 2025 study producing a chromosome-level assembly of 97 chromosomes (8.84 Gb) revealed detailed subgenome structures derived from Saccharum officinarum and S. spontaneum, with clear subgenome dominance patterns . This genomic architecture provides critical context for understanding chloroplast gene inheritance and potential nuclear-cytoplasmic interactions affecting ndhG function. Population genomics analysis of 310 Saccharum accessions has clarified the breeding history of modern sugarcane, revealing bottleneck events and selection pressures that may have influenced organellar genome evolution alongside nuclear genome changes .

Comparative genomic analyses across Saccharum species and related grasses have identified selection signatures in photosynthesis-related genes, including potential co-evolution between nuclear-encoded and chloroplast-encoded components of photosynthetic machinery. The phenomenon of "genome shock" during allopolyploidization, documented to affect transcriptome dynamics in Saccharum hybrid, likely extends to organellar gene expression regulation as well . These genomic insights suggest that while ndhG resides in the chloroplast genome, its expression, function, and evolution are intricately connected to the complex nuclear genome through regulatory interactions and co-evolutionary processes spanning both genomic compartments.

What emerging technologies show promise for ndhG functional characterization?

Emerging technologies offer unprecedented opportunities for detailed functional characterization of ndhG in Saccharum hybrid and related species. CRISPR-Cas9 technology adapted for chloroplast genome editing through chloroplast-targeted nucleases provides precise genetic manipulation capabilities previously unavailable for organellar genes . This approach enables creation of site-specific mutations, precise deletions, or insertions to study structure-function relationships in ndhG without the limitations of traditional transformation methods. Cryo-electron microscopy (cryo-EM) advances now permit structural determination of membrane protein complexes at near-atomic resolution, offering potential for direct visualization of ndhG within the native NDH complex structure.

Single-molecule techniques including single-molecule FRET (Förster Resonance Energy Transfer) enable real-time observation of conformational changes during enzyme catalysis, potentially revealing dynamic aspects of ndhG function within the electron transport chain . Nanopore sequencing technologies facilitate direct RNA sequencing without amplification bias, offering improved transcriptome analysis particularly valuable for highly repetitive complex genomes like sugarcane. Advanced imaging techniques including super-resolution microscopy enable visualization of protein localization and dynamics within chloroplasts at unprecedented spatial resolution. Integration of multi-omics data through machine learning approaches promises comprehensive understanding of ndhG function within the broader context of chloroplast metabolism and plant energy production systems .

What are the implications of ndhG variation for improving photosynthetic efficiency in Saccharum hybrid?

Variation in ndhG sequence and expression patterns has significant implications for photosynthetic efficiency improvement in Saccharum hybrid, offering potential targets for crop enhancement. Recent genome-wide association studies using the haplotype-resolved S. hybrid genome identified potential candidate genes for sugar content from S. spontaneum, suggesting integrated networks between nuclear and chloroplast genes affecting photosynthetic performance . The NDH complex containing ndhG plays crucial roles in photosynthetic efficiency under fluctuating light conditions and various stress scenarios, making it a valuable target for optimization in crop improvement programs.

Analysis of natural variation across Saccharum germplasm reveals allelic diversity in ndhG that correlates with cyclic electron flow capacity and photoprotection efficiency . This natural variation provides genetic resources for breeding programs targeting improved photosynthetic resilience under adverse conditions. Transgenic approaches overexpressing optimized ndhG variants or introducing variants from related species with enhanced stress tolerance offer additional improvement strategies . The complex genome architecture of Saccharum hybrid requires careful consideration of subgenome-specific effects when manipulating chloroplast genes, as nuclear-cytoplasmic interactions significantly influence phenotypic outcomes. Physiological measurements across diverse germplasm under controlled stress conditions demonstrate that enhanced NDH complex activity correlates with improved recovery from high light stress and drought conditions, suggesting practical applications for ndhG optimization in sugarcane breeding programs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.