Recombinant Saccharum hybrid Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to CP47 in Photosystem II

CP47 (encoded by the psbB gene) is an intrinsic chlorophyll-binding protein critical for Photosystem II (PSII) function. It serves as a core antenna complex, facilitating light absorption and energy transfer to the PSII reaction center . Recombinant versions of CP47, such as those expressed in E. coli, enable structural and functional studies of PSII assembly and repair mechanisms .

Protein Structure

  • Sequence: The CP47 apoprotein typically spans 508 amino acids, forming six transmembrane helices with large lumenal loops for chlorophyll and carotenoid binding .

  • Chlorophyll Binding: Binds 16 chlorophyll a molecules and β-carotene, essential for light harvesting .

Table 1: Key Features of Recombinant CP47 Proteins

FeatureDraba nemorosa CP47 Lactuca sativa CP47 Saccharum hybrid PSII Proteins
Host ExpressionE. coliE. coliE. coli (hypothesized)
TagN-terminal HisN-terminal HisNot specified
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)>85% (SDS-PAGE)
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (lyophilized)-20°C/-80°C (lyophilized)
Reconstitution0.1–1.0 mg/mL in water + glycerol0.1–1.0 mg/mL in water + glycerolSimilar protocols inferred

Role in PSII Assembly

  • Precomplex Formation: CP47 associates with PsbH, PsbL, and PsbT during early PSII assembly, forming the RC47 subcomplex before CP43 integration .

  • Chlorophyll Insertion: The Pam68 protein facilitates chlorophyll loading into CP47 during co-translational membrane insertion .

Stress Responses in Saccharum spp.

  • Water Deficit: Sugarcane genotypes show differential expression of PSII-related genes (e.g., psbB) under drought stress, impacting CP47 stability .

  • Re-Watering Recovery: Rapid restoration of PSII activity post-stress correlates with CP43/CP47 reassembly .

Expression Systems

  • E. coli Optimization: High-yield expression requires codon optimization and fusion tags (e.g., His-tag) for purification .

  • Challenges: Chlorophyll incorporation in vitro remains inefficient compared to in vivo systems .

Applications in Research

  • Biophysical Studies: Recombinant CP47 enables spectroscopic analysis of chlorophyll-protein interactions .

  • Mutagenesis: Site-directed mutations in psbB elucidate residues critical for PSII stability .

Future Directions

  • Cryo-EM Structural Analysis: High-resolution structures of recombinant CP47 could reveal mechanisms of chlorophyll binding and energy transfer .

  • Synthetic Biology: Engineering CP47 variants for enhanced stress tolerance in crops like sugarcane .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbB; PS151; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Saccharum hybrid (Sugarcane)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQAA
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the core complex in photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of CP47 (psbB) in Photosystem II function?

CP47 serves as an inner antenna protein within Photosystem II (PSII), playing a crucial role in light harvesting and energy transfer to the reaction center. The protein contains chlorophyll molecules that capture photons and transfer excitation energy toward the PSII core. Research demonstrates that CP47 is essential for maintaining PSII structural integrity and optimizing energy conversion efficiency during photosynthesis. Mutations affecting CP47 typically result in compromised photosynthetic capacity and impaired plant growth .

How is psbB organized in the chloroplast genome of Saccharum species?

The psbB gene is located within the chloroplast genome of Saccharum species, typically found in the large single-copy region. Comparative genomic analyses of chloroplast genomes across the Saccharum complex reveal high conservation of the psbB gene sequence, reflecting its essential photosynthetic function. The gene organization follows the typical monocot pattern, with sequence similarities to other economically important grasses like Sorghum bicolor. Studies on chloroplast genomes of various Saccharum species (including S. officinarum, S. spontaneum, S. robustum, S. sinense, and S. barberi) show minimal variation in the psbB region despite divergence in other parts of the genome .

What evolutionary relationships can be inferred from psbB sequence analysis across Saccharum species?

Phylogenetic analysis based on chloroplast genomes, including the psbB gene, demonstrates clear evolutionary relationships among Saccharum species. The data indicates that S. officinarum and S. robustum share a common ancestor, while S. spontaneum diverged earlier from other Saccharum species. S. sinense and S. barberi cluster together as sister groups to S. robustum and S. officinarum, suggesting they likely had different S. officinarum accessions as ancestors during hybridization events. This has contributed to differences in their genome compositions. Modern cultivated sugarcane hybrids show closer phylogenetic relationships to S. officinarum and S. robustum than to the ancient hybrid species S. sinense and S. barberi .

What strategies are most effective for expressing recombinant psbB from Saccharum hybrids?

Expression of functional recombinant CP47 presents significant challenges due to its integral membrane nature and complex assembly requirements. The most effective approaches involve:

  • Heterologous expression systems: Cyanobacterial systems like Synechocystis sp. PCC 6803 provide advantages for expressing photosynthetic proteins due to their native photosynthetic machinery. When expressing Saccharum psbB, codon optimization is essential to account for differences in codon usage between cyanobacteria and plants.

  • Vector design considerations: Vectors should include appropriate regulatory elements for chloroplast protein expression and targeting sequences for proper membrane integration.

  • Protein stability factors: Supplementation with chlorophyll and other cofactors during expression is crucial, as CP47 requires these molecules for proper folding and stability.

  • Purification strategy: Detergent-based extraction followed by affinity chromatography using poly-histidine tags has proven most effective for isolating functional CP47 protein.

Research indicates that maintaining the association with auxiliary proteins like Psb28 can significantly improve the stability and functional yield of recombinant CP47 .

How do mutations in the psbB gene affect chlorophyll biosynthesis and assembly of photosynthetic complexes?

Studies on photosystem assembly reveal intricate relationships between CP47 expression and chlorophyll biosynthesis pathways. When CP47 synthesis is impaired:

  • Disrupted chlorophyll incorporation: Research shows accumulation of magnesium protoporphyrin IX methylester and decreased levels of protochlorophyllide, indicating inhibition at the cyclization step that forms the isocyclic ring E in the chlorophyll biosynthesis pathway.

  • Feedback inhibition: CP47 deficiency triggers the release of protoporphyrin IX into the cellular environment, suggesting feedback regulation between apoprotein availability and tetrapyrrole synthesis.

  • Pleiotropic effects: Beyond PSII, CP47 deficiency unexpectedly affects PSI assembly, with decreased synthesis of PsaA/PsaB subunits observed in experimental models. This indicates cross-talk between photosystem assembly pathways.

  • Assembly intermediate accumulation: CP47-deficient systems accumulate the RC47 complex (PSII core complex lacking CP43), demonstrating the sequential nature of photosystem assembly .

These findings highlight the coordinated regulation between chlorophyll biosynthesis and photosystem protein expression, with implications for engineering approaches to enhance photosynthetic efficiency.

What molecular markers can distinguish psbB variations across different Saccharum species?

Molecular marker development from chloroplast genome analysis has yielded several useful markers for distinguishing psbB variations:

Marker TypeTarget RegionApplicationSpecies Discrimination
InDel markersIntergenic regions surrounding psbBSaccharum genus identificationDistinguishes Saccharum from related genera
dCAPS markersCoding region polymorphismsSpecies-level discriminationDifferentiates S. officinarum from S. robustum
SNP markersndhF-rpl32 and other regionsPhylogenetic analysisIdentifies evolutionary relationships

The highest frequency of sequence variations has been detected in intergenic regions, with S. spontaneum showing the greatest number of SNPs (68) and InDels (43) compared to other species. In contrast, S. officinarum exhibits minimal variation with only 10 SNPs and 5 InDels detected. S. robustum contains 20 SNPs and 12 InDels, while S. sinense and S. barberi both contain 22 SNPs and 10 InDels. These molecular markers provide essential tools for breeding programs and phylogenetic studies involving Saccharum species .

How can researchers optimize chloroplast genome assembly for accurate psbB sequence analysis in Saccharum species?

Accurate chloroplast genome assembly in Saccharum species requires a multifaceted approach:

  • DNA extraction optimization: High-quality chloroplast DNA extraction requires modified CTAB-based protocols with DNase treatment to eliminate nuclear DNA contamination. Young, etiolated tissue yields better results due to reduced polysaccharide and phenolic compound content.

  • Sequencing strategy: Long-read sequencing technologies (PacBio or Oxford Nanopore) combined with Illumina short reads provide optimal results for complex regions. Coverage of 100-150x is recommended for chloroplast genomes.

  • Assembly validation: After computational assembly, researchers should validate key regions like psbB using PCR amplification and Sanger sequencing, particularly at intron-exon boundaries and regions with repetitive elements.

  • Annotation protocols: Automated annotation should be followed by manual curation, especially for genes like psbB that contain introns and may have species-specific variations in splicing sites.

Comparative analyses of assembled chloroplast genomes across 23 accessions representing 6 Saccharum species demonstrated that this comprehensive approach yields high-quality sequence data suitable for detailed evolutionary and functional studies .

What techniques are most effective for studying the interaction between Psb28 and CP47 during photosystem II biogenesis?

Research on the Psb28-CP47 interaction during photosystem assembly has employed several complementary techniques:

  • Affinity chromatography with tagged proteins: Using histidine-tagged Psb28 has successfully isolated RC47 complexes and unassembled CP47, confirming direct interaction. This approach revealed that while most Psb28 exists as unassembled protein, a small portion associates with the RC47 complex.

  • Membrane fractionation: Differential centrifugation and sucrose gradient separation effectively separate various assembly intermediates of PSII, allowing tracking of Psb28 across different complexes.

  • Radioactive labeling: Pulse-chase experiments with radiolabeled amino acids provide crucial insights into the synthesis rates of CP47 and other photosystem components. This technique revealed that Psb28 deletion mutants have limitations in CP47 synthesis.

  • Metabolite profiling: Chlorophyll biosynthesis intermediates can be quantified using HPLC, allowing researchers to pinpoint where biosynthetic pathways are disrupted. In Psb28 deletion mutants, accumulation of magnesium protoporphyrin IX methylester and decreased protochlorophyllide levels indicated inhibition at the cyclization step of chlorophyll biosynthesis.

  • Dynamic measurements: Tracking D1 protein turnover rates and PSII repair dynamics provides functional context for structural interactions. Psb28 deletion accelerates D1 protein turnover and PSII repair, suggesting regulatory roles beyond direct assembly .

How can researchers differentiate between effects of environmental stress and genetic variation on psbB expression in Saccharum hybrids?

Distinguishing environmental from genetic factors affecting psbB expression requires systematic experimental design:

  • Controlled environment studies: Maintain identical growth conditions (light intensity, temperature, humidity, and nutrient availability) across genotypes to isolate genetic factors. Include appropriate controls for each genotype under standard conditions before stress application.

  • Reciprocal transplant experiments: Exchange plants between environments to separate genetic from environmental effects. This approach is particularly valuable for field studies where complete environmental control is impossible.

  • Quantitative gene expression analysis: Real-time qPCR with multiple reference genes specifically validated for stability under the tested conditions provides the most reliable expression data. Normalize psbB expression against at least three reference genes that show stable expression across treatments.

  • Protein-level validation: Western blotting with anti-CP47 antibodies confirms whether transcriptional changes translate to altered protein levels. Include loading controls that remain stable under the tested conditions.

  • Statistical approaches: Two-way ANOVA with genotype and environment as factors can statistically separate their contributions and identify interaction effects. Calculate the broad-sense heritability (H²) of psbB expression traits to determine the proportion of phenotypic variance attributable to genetic factors.

When environmental factors significantly influence psbB expression, researchers should consider analyzing SNPs in promoter regions and epigenetic modifications that might explain differential responses to environmental cues.

What are the major challenges in generating stable transgenic Saccharum lines with modified psbB expression?

Creating stable transgenic Saccharum lines with modified psbB expression faces several significant challenges:

  • Chloroplast transformation barriers: As psbB is encoded in the chloroplast genome, nuclear transformation methods are insufficient. Chloroplast transformation in Saccharum remains technically challenging due to the thick cell walls and limited tissue culture response of many genotypes.

  • Homoplasmy achievement: Complete replacement of all wild-type chloroplast genomes with transformed versions (homoplasmy) is difficult to achieve in polyploid species like Saccharum that contain multiple chloroplast copies per cell. Multiple rounds of selection are typically required.

  • Functional constraints: Since psbB is essential for photosynthesis, substantial modifications often prove lethal or severely impair growth. Engineering must consider maintaining minimal functionality while achieving desired modifications.

  • Tissue culture recalcitrance: Many commercially important Saccharum genotypes show poor response to tissue culture, limiting transformation efficiency. Genotype-specific optimization of regeneration protocols is often necessary.

  • Selection system limitations: Traditional antibiotic selection markers may have reduced efficiency in chloroplast transformation of Saccharum. Alternative selection strategies might be required for successful transformant identification.

Future approaches should consider specialized biolistic delivery systems optimized for chloroplast transformation, CRISPR-Cas9 adaptation for chloroplast genome editing, and development of site-specific recombination systems for precise genetic modifications.

How can contradictory findings about psbB sequence variations be reconciled across different Saccharum studies?

Contradictory findings regarding psbB sequence variations across Saccharum studies often stem from methodological differences and can be reconciled through:

  • Reference genome standardization: Many studies use different reference genomes, leading to inconsistent variant calling. Establishing a consensus reference chloroplast genome for each Saccharum species would improve comparability.

  • Methodological transparency: Complete documentation of sequencing depth, assembly algorithms, and quality control measures is essential. Differences in coverage depth particularly affect detection of minor variants.

  • Germplasm authentication: Verification of plant material identity through standard molecular markers helps eliminate misidentification as a source of apparent contradictions.

  • Meta-analysis approaches: Integrating data from multiple studies with statistical methods that account for methodological differences can identify robust patterns across datasets.

  • Environmental influences: Some apparent genetic variations may reflect environmentally-induced epigenetic changes or RNA editing rather than DNA sequence differences. Controlling environmental conditions and distinguishing between genomic DNA and transcript sequences is crucial.

Researchers should also consider heteroplasmy (the presence of multiple chloroplast genome variants within a single plant) as a source of apparent contradictions, particularly in hybrid Saccharum species where biparental inheritance of chloroplasts may occasionally occur.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.